Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human PIK3R4 Monoclonal Antibody | anti-PIK3R4 antibody

PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4, PI3-kinase Regulatory Subunit 4, PI3-kinase p150 Subunit, Phosphoinositide 3-kinase Adaptor Protein, MGC102700, p150, VPS15) (HRP)

Gene Names
PIK3R4; p150; VPS15
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIK3R4; Monoclonal Antibody; PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4; PI3-kinase Regulatory Subunit 4; PI3-kinase p150 Subunit; Phosphoinositide 3-kinase Adaptor Protein; MGC102700; p150; VPS15) (HRP); anti-PIK3R4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D4
Specificity
Recognizes human PIK3R4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PIK3R4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1259-1359 from human PIK3R4 (NP_055417) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(PIK3R4 monoclonal antibody, Western Blot analysis of PIK3R4 expression in HeLa.)

Western Blot (WB) (PIK3R4 monoclonal antibody, Western Blot analysis of PIK3R4 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of PIK3R4 expression in transfected 293T cell line by PIK3R4 monoclonal antibody. Lane 1: PIK3R4 transfected lysate (153.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PIK3R4 expression in transfected 293T cell line by PIK3R4 monoclonal antibody. Lane 1: PIK3R4 transfected lysate (153.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PIK3R4 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIK3R4 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of PIK3R4 over-expressed 293 cell line, cotransfected with PIK3R4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIK3R4 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PIK3R4 over-expressed 293 cell line, cotransfected with PIK3R4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIK3R4 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-PIK3R4 antibody
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.
Product Categories/Family for anti-PIK3R4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 149 kDa

Observed: 140 kDa
NCBI Official Full Name
phosphoinositide 3-kinase regulatory subunit 4
NCBI Official Synonym Full Names
phosphoinositide-3-kinase, regulatory subunit 4
NCBI Official Symbol
PIK3R4
NCBI Official Synonym Symbols
p150; VPS15
NCBI Protein Information
phosphoinositide 3-kinase regulatory subunit 4; PI3-kinase p150 subunit; PI3-kinase regulatory subunit 4; phosphoinositide 3-kinase adaptor protein; phosphatidylinositol 3-kinase-associated p150; phosphoinositide-3-kinase, regulatory subunit 4, p150
UniProt Protein Name
Phosphoinositide 3-kinase regulatory subunit 4
UniProt Gene Name
PIK3R4
UniProt Synonym Gene Names
PI3-kinase regulatory subunit 4
UniProt Entry Name
PI3R4_HUMAN

Uniprot Description

PIK3R4: Regulatory subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.

Protein type: EC 2.7.11.1; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Kinase, lipid; Protein kinase, Other; Other group; VPS15 family

Chromosomal Location of Human Ortholog: 3q22.1

Cellular Component: membrane; late endosome; nuclear pore; axoneme; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding; protein kinase activity

Biological Process: macroautophagy; phospholipid metabolic process; late endosome to vacuole transport; toll-like receptor signaling pathway; phosphatidylinositol biosynthetic process; insulin receptor signaling pathway; innate immune response; protein targeting to vacuole; toll-like receptor 9 signaling pathway; peroxisome degradation; protein amino acid phosphorylation

Research Articles on PIK3R4

Similar Products

Product Notes

The PIK3R4 pik3r4 (Catalog #AAA6154172) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4, PI3-kinase Regulatory Subunit 4, PI3-kinase p150 Subunit, Phosphoinositide 3-kinase Adaptor Protein, MGC102700, p150, VPS15) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3R4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3R4 pik3r4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3R4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.