Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human PIK3C2A Monoclonal Antibody | anti-PIK3C2A antibody

PIK3C2A (Phosphatidylinositol 4-phosphate 3-kinase C2 Domain-containing Subunit alpha, Phosphoinositide 3-kinase-C2-alpha, DKFZp686L193, MGC142218) APC

Gene Names
PIK3C2A; CPK; PI3-K-C2A; PI3-K-C2(ALPHA)
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIK3C2A; Monoclonal Antibody; PIK3C2A (Phosphatidylinositol 4-phosphate 3-kinase C2 Domain-containing Subunit alpha; Phosphoinositide 3-kinase-C2-alpha; DKFZp686L193; MGC142218) APC; anti-PIK3C2A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E7
Specificity
Recognizes human PIK3C2A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PIK3C2A antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1577-1687 from human PIK3C2A (NP_002636) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PIK3C2A on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PIK3C2A on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PIK3C2A is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIK3C2A is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-PIK3C2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,742 Da
NCBI Official Full Name
phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
NCBI Official Synonym Full Names
phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha
NCBI Official Symbol
PIK3C2A
NCBI Official Synonym Symbols
CPK; PI3-K-C2A; PI3-K-C2(ALPHA)
NCBI Protein Information
phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha; C2-containing phosphatidylinositol kinase; PI3K-C2-alpha; PI3K-C2alpha; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha; phosphoinositide 3-kinase-C
UniProt Protein Name
Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
UniProt Gene Name
PIK3C2A
UniProt Synonym Gene Names
PI3K-C2-alpha; PtdIns-3-kinase C2 subunit alpha
UniProt Entry Name
P3C2A_HUMAN

Uniprot Description

PIK3C2A: a protein of the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. Its PI3-kinase is not sensitive to nanomolar levels of the inhibitor wortmannin. Activated by insulin and may be involved in integrin-dependent signaling.

Protein type: Carbohydrate Metabolism - inositol phosphate; Kinase, lipid; Motility/polarity/chemotaxis; Autophagy; EC 2.7.1.154

Chromosomal Location of Human Ortholog: 11p15.5-p14

Cellular Component: Golgi apparatus; membrane; clathrin-coated vesicle; cytoplasm; plasma membrane; nucleus; cytosol; phosphoinositide 3-kinase complex; vesicle

Molecular Function: 1-phosphatidylinositol-3-kinase activity; phosphoinositide binding; phosphatidylinositol-4-phosphate 3-kinase activity; ATP binding; phosphoinositide 3-kinase activity

Biological Process: epidermal growth factor receptor signaling pathway; clathrin cage assembly; exocytosis; phosphoinositide-mediated signaling; phosphoinositide phosphorylation; phospholipid metabolic process; phosphatidylinositol biosynthetic process; vascular smooth muscle contraction; insulin receptor signaling pathway; endocytosis; platelet-derived growth factor receptor signaling pathway

Similar Products

Product Notes

The PIK3C2A pik3c2a (Catalog #AAA6138255) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIK3C2A (Phosphatidylinositol 4-phosphate 3-kinase C2 Domain-containing Subunit alpha, Phosphoinositide 3-kinase-C2-alpha, DKFZp686L193, MGC142218) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3C2A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3C2A pik3c2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3C2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.