Mouse anti-Human PIK3C2A Monoclonal Antibody | anti-PIK3C2A antibody

PIK3C2A (Phosphatidylinositol 4-phosphate 3-kinase C2 Domain-containing Subunit alpha, Phosphoinositide 3-kinase-C2-alpha, DKFZp686L193, MGC142218) (FITC)

Cat. Num. AAA6148861

• Gene Names: PIK3C2A; CPK; PI3-K-C2A; PI3-K-C2(ALPHA)
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PIK3C2A; Monoclonal Antibody; PIK3C2A (Phosphatidylinositol 4-phosphate 3-kinase C2 Domain-containing Subunit alpha; Phosphoinositide 3-kinase-C2-alpha; DKFZp686L193; MGC142218) (FITC); anti-PIK3C2A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3E7
• Specificity: Recognizes human PIK3C2A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PIK3C2A antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1577-1687 from human PIK3C2A (NP_002636) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PIK3C2A on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PIK3C2A is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-PIK3C2A antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 157671929
• NCBI GeneID: 5286
• NCBI Accession #: NP_002636
• NCBI GenBank Nucleotide #: NM_002645
• UniProt Accession #: O00443; Q14CQ9; B0LPH2; B4E2G4
• Molecular Weight: 53,742 Da
• NCBI Official Full Name: phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
• NCBI Official Synonym Full Names: phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha
• NCBI Official Symbol: PIK3C2A
• NCBI Official Synonym Symbols: CPK; PI3-K-C2A; PI3-K-C2(ALPHA)
• NCBI Protein Information: phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha; C2-containing phosphatidylinositol kinase; PI3K-C2-alpha; PI3K-C2alpha; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha; phosphoinositide 3-kinase-C
• UniProt Protein Name: Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
• Protein Family: Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing
• UniProt Gene Name: PIK3C2A
• UniProt Synonym Gene Names: PI3K-C2-alpha; PtdIns-3-kinase C2 subunit alpha
• UniProt Entry Name: P3C2A_HUMAN

Uniprot Description

PIK3C2A: a protein of the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. Its PI3-kinase is not sensitive to nanomolar levels of the inhibitor wortmannin. Activated by insulin and may be involved in integrin-dependent signaling.

Protein type: Carbohydrate Metabolism - inositol phosphate; Kinase, lipid; Motility/polarity/chemotaxis; Autophagy; EC 2.7.1.154

Chromosomal Location of Human Ortholog: 11p15.5-p14

Cellular Component: Golgi apparatus; membrane; clathrin-coated vesicle; cytoplasm; plasma membrane; nucleus; cytosol; phosphoinositide 3-kinase complex; vesicle

Molecular Function: 1-phosphatidylinositol-3-kinase activity; phosphoinositide binding; phosphatidylinositol-4-phosphate 3-kinase activity; ATP binding; phosphoinositide 3-kinase activity

Biological Process: epidermal growth factor receptor signaling pathway; clathrin cage assembly; exocytosis; phosphoinositide-mediated signaling; phosphoinositide phosphorylation; phospholipid metabolic process; phosphatidylinositol biosynthetic process; vascular smooth muscle contraction; insulin receptor signaling pathway; endocytosis; platelet-derived growth factor receptor signaling pathway