Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human PI4KB Monoclonal Antibody | anti-PI4KB antibody

PI4KB (PIK4CB, Phosphatidylinositol 4-kinase beta, PI4K-beta, PI4Kbeta, PtdIns 4-kinase beta, NPIK, PI4K92) (HRP)

Gene Names
PI4KB; NPIK; PI4K92; PIK4CB; PI4KBETA; PI4K-BETA; PI4KIIIBETA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PI4KB; Monoclonal Antibody; PI4KB (PIK4CB; Phosphatidylinositol 4-kinase beta; PI4K-beta; PI4Kbeta; PtdIns 4-kinase beta; NPIK; PI4K92) (HRP); anti-PI4KB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B1
Specificity
Recognizes human PIK4CB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PI4KB antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa731-829 from human PIK4CB (NP_002642) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged PIK4CB is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIK4CB is ~3ng/ml as a capture antibody.)
Related Product Information for anti-PI4KB antibody
Phosphoinositides are pivotal precursors to important second messengers and as signaling and molecules. Phosphatidylinositol 4-kinases (PI4Ks) are are crucial regulators of the phosphoinsitide cascade. PI4KCB is a wortmannin-sensitive PI 4-kinase responsible for regulating the synthesis of agonist-sensitive pools of polyphosphoinositides. The cellular reservoir of PI4KCB is predominantly cytosolic, however the protein is is activated strongly by recruitment to the membrane to stimulate phosphatidylinositol 4,5-bisphosphate synthesis at the plasma membrane. PI4KCB contains an N-terminal lipid kinase unique domain, which is shared by members of both the PI3 kinase and PI4 kinase families, and a C-terminal catalytic domain, which defines this protein as a member of a much larger protein/lipid kinase family.
Product Categories/Family for anti-PI4KB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
phosphatidylinositol 4-kinase beta isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol 4-kinase beta
NCBI Official Symbol
PI4KB
NCBI Official Synonym Symbols
NPIK; PI4K92; PIK4CB; PI4KBETA; PI4K-BETA; PI4KIIIBETA
NCBI Protein Information
phosphatidylinositol 4-kinase beta
UniProt Protein Name
Phosphatidylinositol 4-kinase beta
UniProt Gene Name
PI4KB
UniProt Synonym Gene Names
PIK4CB; PI4K-beta; PI4Kbeta
UniProt Entry Name
PI4KB_HUMAN

Uniprot Description

PIK4CB: a member of the PI3/PI4 kinase family. Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol- 1,4,5,-trisphosphate. Found in the outer membrane of mitochondria and membranes of the rough endoplasmic reticulum. Recruited to the Golgi complex by the small GTPase ARF to stimulate the synthesis of phosphatidylinositol 4,5-biphosphate (PIP2) on the Golgi complex. May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Three splice-variant isoforms have been described.

Protein type: Kinase, lipid; EC 2.7.1.67; Motility/polarity/chemotaxis; Carbohydrate Metabolism - inositol phosphate

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: Golgi membrane; mitochondrial outer membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; rough endoplasmic reticulum membrane; cytosol; endosome

Molecular Function: 1-phosphatidylinositol 4-kinase activity; protein binding; ATP binding

Biological Process: receptor-mediated endocytosis; phosphoinositide-mediated signaling; phosphoinositide phosphorylation; phospholipid metabolic process; phosphatidylinositol biosynthetic process; signal transduction

Research Articles on PI4KB

Similar Products

Product Notes

The PI4KB pi4kb (Catalog #AAA6154146) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PI4KB (PIK4CB, Phosphatidylinositol 4-kinase beta, PI4K-beta, PI4Kbeta, PtdIns 4-kinase beta, NPIK, PI4K92) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PI4KB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PI4KB pi4kb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PI4KB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.