Mouse anti-Human PI4KB Monoclonal Antibody | anti-PI4KB antibody

PI4KB (PIK4CB, Phosphatidylinositol 4-kinase beta, PI4K-beta, PI4Kbeta, PtdIns 4-kinase beta, NPIK, PI4K92) (Biotin)

Cat. Num. AAA6143540

• Gene Names: PI4KB; NPIK; PI4K92; PIK4CB; PI4KBETA; PI4K-BETA; PI4KIIIBETA
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PI4KB; Monoclonal Antibody; PI4KB (PIK4CB; Phosphatidylinositol 4-kinase beta; PI4K-beta; PI4Kbeta; PtdIns 4-kinase beta; NPIK; PI4K92) (Biotin); anti-PI4KB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3B1
• Specificity: Recognizes human PIK4CB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PI4KB antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa731-829 from human PIK4CB (NP_002642) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged PIK4CB is ~3ng/ml as a capture antibody.)

Related Product Information for anti-PI4KB antibody

Phosphoinositides are pivotal precursors to important second messengers and as signaling and molecules. Phosphatidylinositol 4-kinases (PI4Ks) are are crucial regulators of the phosphoinsitide cascade. PI4KCB is a wortmannin-sensitive PI 4-kinase responsible for regulating the synthesis of agonist-sensitive pools of polyphosphoinositides. The cellular reservoir of PI4KCB is predominantly cytosolic, however the protein is is activated strongly by recruitment to the membrane to stimulate phosphatidylinositol 4,5-bisphosphate synthesis at the plasma membrane. PI4KCB contains an N-terminal lipid kinase unique domain, which is shared by members of both the PI3 kinase and PI4 kinase families, and a C-terminal catalytic domain, which defines this protein as a member of a much larger protein/lipid kinase family.

Product Categories/Family for anti-PI4KB antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505809
• NCBI GeneID: 5298
• NCBI Accession #: NP_002642
• NCBI GenBank Nucleotide #: NM_002651
• UniProt Accession #: Q9UBF8
• Molecular Weight: 93kDa
• NCBI Official Full Name: phosphatidylinositol 4-kinase beta isoform 1
• NCBI Official Synonym Full Names: phosphatidylinositol 4-kinase beta
• NCBI Official Symbol: PI4KB
• NCBI Official Synonym Symbols: NPIK; PI4K92; PIK4CB; PI4KBETA; PI4K-BETA; PI4KIIIBETA
• NCBI Protein Information: phosphatidylinositol 4-kinase beta
• UniProt Protein Name: Phosphatidylinositol 4-kinase beta
• Protein Family: Phosphatidylinositol 4-kinase
• UniProt Gene Name: PI4KB
• UniProt Synonym Gene Names: PIK4CB; PI4K-beta; PI4Kbeta
• UniProt Entry Name: PI4KB_HUMAN

Uniprot Description

PIK4CB: a member of the PI3/PI4 kinase family. Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol- 1,4,5,-trisphosphate. Found in the outer membrane of mitochondria and membranes of the rough endoplasmic reticulum. Recruited to the Golgi complex by the small GTPase ARF to stimulate the synthesis of phosphatidylinositol 4,5-biphosphate (PIP2) on the Golgi complex. May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Three splice-variant isoforms have been described.

Protein type: Kinase, lipid; EC 2.7.1.67; Motility/polarity/chemotaxis; Carbohydrate Metabolism - inositol phosphate

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: Golgi membrane; mitochondrial outer membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; rough endoplasmic reticulum membrane; cytosol; endosome

Molecular Function: 1-phosphatidylinositol 4-kinase activity; protein binding; ATP binding

Biological Process: receptor-mediated endocytosis; phosphoinositide-mediated signaling; phosphoinositide phosphorylation; phospholipid metabolic process; phosphatidylinositol biosynthetic process; signal transduction