Mouse anti-Human, Rat PHOX2A Monoclonal Antibody | anti-PHOX2A antibody

PHOX2A (Paired Mesoderm Homeobox Protein 2A, ARIX1 Homeodomain Protein, Aristaless Homeobox Protein Homolog, Paired-like Homeobox 2A, ARIX, PMX2A) (FITC)

Cat. Num. AAA6148839

• Gene Names: PHOX2A; ARIX; FEOM2; NCAM2; PMX2A; CFEOM2
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PHOX2A; Monoclonal Antibody; PHOX2A (Paired Mesoderm Homeobox Protein 2A; ARIX1 Homeodomain Protein; Aristaless Homeobox Protein Homolog; Paired-like Homeobox 2A; ARIX; PMX2A) (FITC); anti-PHOX2A antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F6
• Specificity: Recognizes human PHOX2A. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PHOX2A antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-90 from human PHOX2A (NP_005160) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(PHOX2A monoclonal antibody Western Blot analysis of PHOX2A expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody. Lane 1: PHOX2A transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PHOX2A on HeLa cell. [antibody concentration 10ug/ml].)

Western Blot (WB)

(Western blot analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PHOX2A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-PHOX2A antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 46249382
• NCBI GeneID: 401
• NCBI Accession #: NP_005160
• NCBI GenBank Nucleotide #: NM_005169
• UniProt Accession #: O14813; Q8IVZ2; A8K3N0
• Molecular Weight: 29,653 Da
• NCBI Official Full Name: paired mesoderm homeobox protein 2A
• NCBI Official Synonym Full Names: paired-like homeobox 2a
• NCBI Official Symbol: PHOX2A
• NCBI Official Synonym Symbols: ARIX; FEOM2; NCAM2; PMX2A; CFEOM2
• NCBI Protein Information: paired mesoderm homeobox protein 2A; arix homeodomain protein; ARIX1 homeodomain protein; aristaless homeobox homolog; aristaless homeobox protein homolog
• UniProt Protein Name: Paired mesoderm homeobox protein 2A
• Protein Family: Paired mesoderm homeobox protein
• UniProt Gene Name: PHOX2A
• UniProt Synonym Gene Names: ARIX; PMX2A
• UniProt Entry Name: PHX2A_HUMAN

NCBI Description

The protein encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles. [provided by RefSeq, Jul 2008]

Uniprot Description

PHOX2A: May be involved in regulating the specificity of expression of the catecholamine biosynthetic genes. Acts as a transcription activator/factor. Could maintain the noradrenergic phenotype. Defects in PHOX2A are the cause of congenital fibrosis of extraocular muscles type 2 (CFEOM2). CFEOM encompasses several different inherited strabismus syndromes characterized by congenital restrictive ophthalmoplegia affecting extraocular muscles innervated by the oculomotor and/or trochlear nerves. CFEOM is characterized clinically by anchoring of the eyes in downward gaze, ptosis, and backward tilt of the head. CFEOM2 may result from the aberrant development of the oculomotor (nIII), trochlear (nIV) and abducens (nVI) cranial nerve nuclei. Belongs to the paired homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: nuclear chromatin

Molecular Function: transcription factor activity

Biological Process: sympathetic nervous system development; regulation of respiratory gaseous exchange; trochlear nerve formation; transcription, DNA-dependent; oculomotor nerve formation; somatic motor neuron differentiation; midbrain development; positive regulation of transcription from RNA polymerase II promoter; locus ceruleus development

Disease: Fibrosis Of Extraocular Muscles, Congenital, 2