Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human PHLDA2 Monoclonal Antibody | anti-PHLDA2 antibody

PHLDA2 (Pleckstrin Homology-like Domain Family A Member 2, Beckwith-Wiedemann Syndrome Chromosomal Region 1 Candidate Gene C Protein, Imprinted in Placenta and Liver Protein, Tumor-suppressing STF cDNA 3 Protein, Tumor-suppressing Subchromosomal Transfera

Gene Names
PHLDA2; IPL; BRW1C; BWR1C; HLDA2; TSSC3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PHLDA2; Monoclonal Antibody; PHLDA2 (Pleckstrin Homology-like Domain Family A Member 2; Beckwith-Wiedemann Syndrome Chromosomal Region 1 Candidate Gene C Protein; Imprinted in Placenta and Liver Protein; Tumor-suppressing STF cDNA 3 Protein; Tumor-suppressing Subchromosomal Transfera; anti-PHLDA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E3
Specificity
Recognizes human PHLDA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PHLDA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human PHLDA2 (NP_003302) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged PHLDA2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PHLDA2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-PHLDA2 antibody
This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver.
Product Categories/Family for anti-PHLDA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.2 kDa (172aa), confirmed by MALDI-TOF
NCBI Official Full Name
pleckstrin homology-like domain family A member 2
NCBI Official Synonym Full Names
pleckstrin homology like domain family A member 2
NCBI Official Symbol
PHLDA2
NCBI Official Synonym Symbols
IPL; BRW1C; BWR1C; HLDA2; TSSC3
NCBI Protein Information
pleckstrin homology-like domain family A member 2
UniProt Protein Name
Pleckstrin homology-like domain family A member 2
UniProt Gene Name
PHLDA2
UniProt Synonym Gene Names
BWR1C; HLDA2; IPL; TSSC3; p17-BWR1C
UniProt Entry Name
PHLA2_HUMAN

NCBI Description

This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver. [provided by RefSeq, Oct 2010]

Uniprot Description

PHLDA2: a protein may play a role in regulating placenta growth. Contains one PH domain. Expressed in placenta and adult prostate gland. Expressed at low levels in adult liver and lung, and fetal liver. Expressed in adult brain and neuroblastoma, medullablastoma and glioblastoma cell lines.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: membrane; cytoplasm

Biological Process: organ morphogenesis; apoptosis; regulation of gene expression; regulation of embryonic development; regulation of cell migration; placenta development

Research Articles on PHLDA2

Similar Products

Product Notes

The PHLDA2 phlda2 (Catalog #AAA6138224) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PHLDA2 (Pleckstrin Homology-like Domain Family A Member 2, Beckwith-Wiedemann Syndrome Chromosomal Region 1 Candidate Gene C Protein, Imprinted in Placenta and Liver Protein, Tumor-suppressing STF cDNA 3 Protein, Tumor-suppressing Subchromosomal Transfera reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHLDA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHLDA2 phlda2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHLDA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.