Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Mouse anti-Human MAP3K15 Monoclonal Antibody | anti-MAP3K15 antibody

MAP3K15 (ASK3, Mitogen-activated Protein Kinase Kinase Kinase 15, Apoptosis Signal-regulating Kinase 3, MAPK/ERK Kinase Kinase 15, FLJ16518) (AP)

Gene Names
MAP3K15; ASK3; bA723P2.3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAP3K15; Monoclonal Antibody; MAP3K15 (ASK3; Mitogen-activated Protein Kinase Kinase Kinase 15; Apoptosis Signal-regulating Kinase 3; MAPK/ERK Kinase Kinase 15; FLJ16518) (AP); anti-MAP3K15 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1H7
Specificity
Recognizes human MAP3K15.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MAP3K15 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa691-787 from human MAP3K15 (NP_001001671) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKD*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Testing Data

(Detection limit for recombinant GST tagged MAP3K15 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAP3K15 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-MAP3K15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 15
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 15
NCBI Official Symbol
MAP3K15
NCBI Official Synonym Symbols
ASK3; bA723P2.3
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 15
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 15
UniProt Gene Name
MAP3K15
UniProt Synonym Gene Names
ASK3; MEK kinase 15; MEKK 15
UniProt Entry Name
M3K15_HUMAN

NCBI Description

The protein encoded by this gene is a member of the mitogen-activated protein kinase (MAPK) family. These family members function in a protein kinase signal transduction cascade, where an activated MAPK kinase kinase (MAP3K) phosphorylates and activates a specific MAPK kinase (MAP2K), which then activates a specific MAPK. This MAP3K protein plays an essential role in apoptotic cell death triggered by cellular stresses. [provided by RefSeq, Jul 2010]

Research Articles on MAP3K15

Similar Products

Product Notes

The MAP3K15 map3k15 (Catalog #AAA6132201) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAP3K15 (ASK3, Mitogen-activated Protein Kinase Kinase Kinase 15, Apoptosis Signal-regulating Kinase 3, MAPK/ERK Kinase Kinase 15, FLJ16518) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP3K15 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP3K15 map3k15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP3K15, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.