Mouse anti-Human PHC1 Monoclonal Antibody | anti-PHC1 antibody

PHC1 (Polyhomeotic-like Protein 1, hPH1, Early Development Regulatory Protein 1, EDR1, PH1) APC

Cat. Num. AAA6138212

• Gene Names: PHC1; EDR1; HPH1; RAE28; MCPH11
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PHC1; Monoclonal Antibody; PHC1 (Polyhomeotic-like Protein 1; hPH1; Early Development Regulatory Protein 1; EDR1; PH1) APC; anti-PHC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G1
• Specificity: Recognizes human PHC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 1004

• Applicable Applications for anti-PHC1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa751-851 from human PHC1 (NP_004417) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANY*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged PHC1 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-PHC1 antibody

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.

Product Categories/Family for anti-PHC1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 62953127
• NCBI GeneID: 1911
• NCBI Accession #: NP_004417
• NCBI GenBank Nucleotide #: NM_004426
• UniProt Accession #: P78364
• NCBI Official Full Name: polyhomeotic-like protein 1
• NCBI Official Synonym Full Names: polyhomeotic homolog 1
• NCBI Official Symbol: PHC1
• NCBI Official Synonym Symbols: EDR1; HPH1; RAE28; MCPH11
• NCBI Protein Information: polyhomeotic-like protein 1
• UniProt Protein Name: Polyhomeotic-like protein 1
• Protein Family: Polyhomeotic-like protein
• UniProt Gene Name: PHC1
• UniProt Synonym Gene Names: EDR1; PH1; hPH1
• UniProt Entry Name: PHC1_HUMAN

NCBI Description

This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein. [provided by RefSeq, Jul 2008]