Testing Data
(Detection limit for recombinant GST tagged PGAM1 is approximately 0.3ng/ml as a capture antibody.)
Mouse PGAM1 Monoclonal Antibody | anti-PGAM1 antibody
PGAM1 (Phosphoglycerate Mutase 1 (Brain), PGAM-B, PGAMA) (APC)
Gene Names
PGAM1; PGAMA; PGAM-B; HEL-S-35
Applications
Immunoprecipitation
Purity
Purified
Synonyms
PGAM1; Monoclonal Antibody; PGAM1 (Phosphoglycerate Mutase 1 (Brain); PGAM-B; PGAMA) (APC); Phosphoglycerate Mutase 1 (Brain); PGAMA; anti-PGAM1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F5-D8
Specificity
Recognizes PGAM1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
254
Applicable Applications for anti-PGAM1 antibody
Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PGAM1 (AAH11678.1, 1aa-254aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PGAM1 is approximately 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PGAM1 is approximately 0.3ng/ml as a capture antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of PGAM1 transfected lysate using anti-PGAM1 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with PGAM1 monoclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of PGAM1 transfected lysate using anti-PGAM1 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with PGAM1 monoclonal antibody.)
Related Product Information for anti-PGAM1 antibody
Mouse monoclonal antibody raised against a full-length recombinant PGAM1.
Product Categories/Family for anti-PGAM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Phosphoglycerate mutase 1 (brain)
NCBI Official Synonym Full Names
phosphoglycerate mutase 1
NCBI Official Symbol
PGAM1
NCBI Official Synonym Symbols
PGAMA; PGAM-B; HEL-S-35
NCBI Protein Information
phosphoglycerate mutase 1
Protein Family
NCBI Description
The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Research Articles on PGAM1
Similar Products
Product Notes
The PGAM1 (Catalog #AAA6168727) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PGAM1 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGAM1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGAM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
