Mouse anti-Human PEX6 Monoclonal Antibody | anti-PEX6 antibody

PEX6 (PXAAA1, Peroxisome Assembly Factor 2, PAF-2, Peroxisomal-type ATPase 1, Peroxisomal Biogenesis Factor 6, Peroxin 6) (MaxLight 750)

Cat. Num. AAA6234452

• Gene Names: PEX6; PAF2; PAF-2; PBD4A; PDB4B; PXAAA1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PEX6; Monoclonal Antibody; PEX6 (PXAAA1; Peroxisome Assembly Factor 2; PAF-2; Peroxisomal-type ATPase 1; Peroxisomal Biogenesis Factor 6; Peroxin 6) (MaxLight 750); anti-PEX6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G3
• Specificity: Recognizes human PEX6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-PEX6 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa881-981 from human PEX6 (NP_000278) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RVLSAITRKFKLEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAAC
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-PEX6 antibody

This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) family of ATPases. This member is a predominantly cytoplasmic protein, which plays a direct role in peroxisomal protein import and is required for PTS1 (peroxisomal targeting signal 1, a C-terminal tripeptide of the sequence ser-lys-leu) receptor activity. Mutations in this gene cause peroxisome biogenesis disorders of complementation group 4 and complementation group 6. [provided by RefSeq]

Product Categories/Family for anti-PEX6 antibody

Antibodies; Obesity Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 194018488
• NCBI GeneID: 5190
• NCBI Accession #: NP_000278
• NCBI GenBank Nucleotide #: NM_000287
• UniProt Accession #: Q13608; Q5T8W1; Q8WYQ0; Q8WYQ1; Q8WYQ2; Q99476
• Molecular Weight: 94,571 Da
• NCBI Official Full Name: peroxisome biogenesis factor 6
• NCBI Official Synonym Full Names: peroxisomal biogenesis factor 6
• NCBI Official Symbol: PEX6
• NCBI Official Synonym Symbols: PAF2; PAF-2; PBD4A; PDB4B; PXAAA1
• NCBI Protein Information: peroxisome biogenesis factor 6; peroxin-6; peroxisomal AAA-type ATPase 1; peroxisomal-type ATPase 1; peroxisome assembly factor 2
• UniProt Protein Name: Peroxisome assembly factor 2
• Protein Family: Peroxisomal ATPase
• UniProt Gene Name: PEX6
• UniProt Synonym Gene Names: PXAAA1; PAF-2

Uniprot Description

Involved in peroxisome biosynthesis. Required for stability of the PTS1 receptor. Anchored by PEX26 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes.