Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human PEX6 Monoclonal Antibody | anti-PEX6 antibody

PEX6 (PXAAA1, Peroxisome Assembly Factor 2, PAF-2, Peroxisomal-type ATPase 1, Peroxisomal Biogenesis Factor 6, Peroxin 6) (AP)

Gene Names
PEX6; PAF2; PAF-2; PBD4A; PDB4B; PXAAA1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PEX6; Monoclonal Antibody; PEX6 (PXAAA1; Peroxisome Assembly Factor 2; PAF-2; Peroxisomal-type ATPase 1; Peroxisomal Biogenesis Factor 6; Peroxin 6) (AP); anti-PEX6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G3
Specificity
Recognizes human PEX6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PEX6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa881-981 from human PEX6 (NP_000278) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVLSAITRKFKLEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAAC
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(PEX6 monoclonal antibody. Western Blot analysis of PEX6 expression in K-562.)

Western Blot (WB) (PEX6 monoclonal antibody. Western Blot analysis of PEX6 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged PEX6 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PEX6 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-PEX6 antibody
This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) family of ATPases. This member is a predominantly cytoplasmic protein, which plays a direct role in peroxisomal protein import and is required for PTS1 (peroxisomal targeting signal 1, a C-terminal tripeptide of the sequence ser-lys-leu) receptor activity. Mutations in this gene cause peroxisome biogenesis disorders of complementation group 4 and complementation group 6. [provided by RefSeq]
Product Categories/Family for anti-PEX6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94,571 Da
NCBI Official Full Name
peroxisome biogenesis factor 6
NCBI Official Synonym Full Names
peroxisomal biogenesis factor 6
NCBI Official Symbol
PEX6
NCBI Official Synonym Symbols
PAF2; PAF-2; PBD4A; PDB4B; PXAAA1
NCBI Protein Information
peroxisome biogenesis factor 6; peroxin-6; peroxisomal AAA-type ATPase 1; peroxisomal-type ATPase 1; peroxisome assembly factor 2
UniProt Protein Name
Peroxisome assembly factor 2
Protein Family
UniProt Gene Name
PEX6
UniProt Synonym Gene Names
PXAAA1; PAF-2

Uniprot Description

Involved in peroxisome biosynthesis. Required for stability of the PTS1 receptor. Anchored by PEX26 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes.

Similar Products

Product Notes

The PEX6 pex6 (Catalog #AAA6132888) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PEX6 (PXAAA1, Peroxisome Assembly Factor 2, PAF-2, Peroxisomal-type ATPase 1, Peroxisomal Biogenesis Factor 6, Peroxin 6) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PEX6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PEX6 pex6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PEX6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.