Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PEX19 expression in transfected 293T cell line by PEX19 monoclonal antibody. Lane 1: PEX19 transfected lysate (32.8kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PEX19 Monoclonal Antibody | anti-PEX19 antibody

PEX19 (HK33, PXF, Peroxisomal Biogenesis Factor 19, 33kD Housekeeping Protein, Peroxin-19, Peroxisomal Farnesylated Protein) (PE)

Gene Names
PEX19; PXF; HK33; PMP1; PMPI; PXMP1; PBD12A; D1S2223E
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PEX19; Monoclonal Antibody; PEX19 (HK33; PXF; Peroxisomal Biogenesis Factor 19; 33kD Housekeeping Protein; Peroxin-19; Peroxisomal Farnesylated Protein) (PE); anti-PEX19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E4
Specificity
Recognizes human PEX19.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PEX19 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human PEX19, aa1-300 (AAH00496) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQGIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDAPNLSGPPGASGEQCLIM
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PEX19 expression in transfected 293T cell line by PEX19 monoclonal antibody. Lane 1: PEX19 transfected lysate (32.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PEX19 expression in transfected 293T cell line by PEX19 monoclonal antibody. Lane 1: PEX19 transfected lysate (32.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PEX19 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PEX19 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-PEX19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
– Da
NCBI Official Full Name
Homo sapiens peroxisomal biogenesis factor 19, mRNA
NCBI Official Synonym Full Names
peroxisomal biogenesis factor 19
NCBI Official Symbol
PEX19
NCBI Official Synonym Symbols
PXF; HK33; PMP1; PMPI; PXMP1; PBD12A; D1S2223E
NCBI Protein Information
peroxisomal biogenesis factor 19

NCBI Description

This gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. These disorders have at least 14 complementation groups, with more than one phenotype being observed for some complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14), which is also known as PBD-CGJ. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010]

Research Articles on PEX19

Similar Products

Product Notes

The PEX19 (Catalog #AAA6159401) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PEX19 (HK33, PXF, Peroxisomal Biogenesis Factor 19, 33kD Housekeeping Protein, Peroxin-19, Peroxisomal Farnesylated Protein) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PEX19 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PEX19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PEX19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.