Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GNG11 expression in transfected 293T cell line by GNG11 polyclonal antibody. Lane 1: GNG11 transfected lysate (8.5kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human GNG11 Polyclonal Antibody | anti-GNG11 antibody

GNG11 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-11, GNGT11)

Gene Names
GNG11; GNGT11
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GNG11; Polyclonal Antibody; GNG11 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-11; GNGT11); Anti -GNG11 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-11; anti-GNG11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GNG11.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
Applicable Applications for anti-GNG11 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GNG11, aa1-73 (NP_004117.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GNG11 expression in transfected 293T cell line by GNG11 polyclonal antibody. Lane 1: GNG11 transfected lysate (8.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GNG11 expression in transfected 293T cell line by GNG11 polyclonal antibody. Lane 1: GNG11 transfected lysate (8.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GNG11 antibody
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Product Categories/Family for anti-GNG11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,481 Da
NCBI Official Full Name
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
NCBI Official Synonym Full Names
guanine nucleotide binding protein (G protein), gamma 11
NCBI Official Symbol
GNG11
NCBI Official Synonym Symbols
GNGT11
NCBI Protein Information
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; G protein gamma-11 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit
UniProt Protein Name
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
UniProt Gene Name
GNG11
UniProt Synonym Gene Names
GNGT11
UniProt Entry Name
GBG11_HUMAN

NCBI Description

This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq, Jul 2008]

Uniprot Description

G-gamma 11: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. Belongs to the G protein gamma family.

Protein type: G protein, heterotrimeric gamma

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: plasma membrane; heterotrimeric G-protein complex

Molecular Function: GTPase activity; signal transducer activity

Biological Process: G-protein coupled receptor protein signaling pathway; energy reserve metabolic process; signal transduction

Research Articles on GNG11

Similar Products

Product Notes

The GNG11 gng11 (Catalog #AAA6012717) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GNG11 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-11, GNGT11) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNG11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GNG11 gng11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPALHIEDLP EKEKLKMEVE QLRKEVKLQR QQVSKCSEEI KNYIEERSGE DPLVKGIPED KNPFKEKGSC VIS. It is sometimes possible for the material contained within the vial of "GNG11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.