Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using THOC3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Rabbit anti-Human, Mouse THOC3 Polyclonal Antibody | anti-THOC3 antibody

THOC3 Polyclonal Antibody

Gene Names
THOC3; THO3; hTREX45
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
THOC3; Polyclonal Antibody; THOC3 Polyclonal Antibody; hTREX45; THO3; anti-THOC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT
Sequence Length
351
Applicable Applications for anti-THOC3 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human THOC3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, Nucleus speckle
Positive Samples
LO2, Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using THOC3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using THOC3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-THOC3 antibody
This gene encodes a component of the nuclear THO transcription elongation complex, which is part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. In humans, the transcription export complex is recruited to the 5'-end of messenger RNAs in a splicing- and cap-dependent manner. Studies of a related complex in mouse suggest that the metazoan transcription export complex is involved in cell differentiation and development. A pseudogene of this gene has been defined on chromosome 5.
Product Categories/Family for anti-THOC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 36kDa; 38kDa
Observed: 39kDa
NCBI Official Full Name
THO complex subunit 3
NCBI Official Synonym Full Names
THO complex 3
NCBI Official Symbol
THOC3
NCBI Official Synonym Symbols
THO3; hTREX45
NCBI Protein Information
THO complex subunit 3
UniProt Protein Name
THO complex subunit 3
UniProt Gene Name
THOC3
UniProt Synonym Gene Names
Tho3

NCBI Description

This gene encodes a component of the nuclear THO transcription elongation complex, which is part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. In humans, the transcription export complex is recruited to the 5'-end of messenger RNAs in a splicing- and cap-dependent manner. Studies of a related complex in mouse suggest that the metazoan transcription export complex is involved in cell differentiation and development. A pseudogene of this gene has been defined on chromosome 5. [provided by RefSeq, May 2013]

Uniprot Description

Required for efficient export of polyadenylated RNA and spliced mRNA. Acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.

Research Articles on THOC3

Similar Products

Product Notes

The THOC3 thoc3 (Catalog #AAA9133278) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THOC3 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's THOC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the THOC3 thoc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAVPAAAMGP SALGQSGPGS MAPWCSVSSG PSRYVLGMQE LFRGHSKTRE FLAHSAKVHS VAWSCDGRRL ASGSFDKTAS VFLLEKDRLV KENNYRGHGD SVDQLCWHPS NPDLFVTASG DKTIRIWDVR TTKCIATVNT KGENINICWS PDGQTIAVGN KDDVVTFIDA KTHRSKAEEQ FKFEVNEISW NNDNNMFFLT. It is sometimes possible for the material contained within the vial of "THOC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.