Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (47.08kD).)

Mouse anti-Human PDGFRA Monoclonal Antibody | anti-PDGFRA antibody

PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) (HRP)

Gene Names
PDGFRA; GAS9; CD140A; PDGFR2; PDGFR-2; RHEPDGFRA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDGFRA; Monoclonal Antibody; PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor; PDGF-R-alpha; CD140 Antigen-like Family Member A; CD140a Antigen; CD140a; MGC74795) (HRP); anti-PDGFRA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D2-1A11
Specificity
Recognizes human PDGFRA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PDGFRA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa25-218 from human PDGFRA (AAH15186) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (47.08kD).)

Western Blot (WB) (Western Blot detection against Immunogen (47.08kD).)

Western Blot (WB)

(Western Blot analysis of PDGFRA expression in transfected 293T cell line by 131068. Lane 1: PDGFRA transfected lysate (Predicted MW: 122.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDGFRA expression in transfected 293T cell line by 131068. Lane 1: PDGFRA transfected lysate (Predicted MW: 122.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PDGFRA is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PDGFRA is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between PDGFA and PDGFRA HeLa cells were stained with PDGFA rabbit purified polyclonal (1:1200) and 131068 (1:50). Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between PDGFA and PDGFRA HeLa cells were stained with PDGFA rabbit purified polyclonal (1:1200) and 131068 (1:50). Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Related Product Information for anti-PDGFRA antibody
PDGFRA is a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies in knockout mice, where homozygosity is lethal, indicate that the alpha form of the platelet-derived growth factor receptor is particularly important for kidney development since mice heterozygous for the receptor exhibit defective kidney phenotypes.
Product Categories/Family for anti-PDGFRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
82,809 Da
NCBI Official Full Name
Homo sapiens platelet-derived growth factor receptor, alpha polypeptide, mRNA
NCBI Official Synonym Full Names
platelet derived growth factor receptor alpha
NCBI Official Symbol
PDGFRA
NCBI Official Synonym Symbols
GAS9; CD140A; PDGFR2; PDGFR-2; RHEPDGFRA
NCBI Protein Information
platelet-derived growth factor receptor alpha
UniProt Protein Name
Platelet-derived growth factor receptor alpha
UniProt Gene Name
PDGFRA
UniProt Synonym Gene Names
PDGFR2; RHEPDGFRA; PDGF-R-alpha; PDGFR-alpha; PDGFR-2
UniProt Entry Name
PGFRA_HUMAN

NCBI Description

This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies suggest that this gene plays a role in organ development, wound healing, and tumor progression. Mutations in this gene have been associated with idiopathic hypereosinophilic syndrome, somatic and familial gastrointestinal stromal tumors, and a variety of other cancers. [provided by RefSeq, Mar 2012]

Uniprot Description

PDGFRA: a receptor tyrosine kinase of the PDGFR family that binds members of the platelet-derived growth factor family. The identity of the growth factor bound determines whether the functional receptor is a homodimer or a heterodimer, composed of both PDGFR-alpha and -beta. Ligand binding induces receptor dimerization and autophosphorylation. Particularly important for kidney development since mice heterozygous for the receptor exhibit defective kidney phenotypes. Chromosomal rearrangments activate PDGFRalpha by fusion to BCR, causing atypical chronic myelogenous leukemia (CML), and to FIP1L1, causing idiopathic hypereosinophilic syndrome. Activating point mutations cause a minority of gastrointestinal stromal tumors (GIST). Promoter polymorphisms linked to neural tube defects including spina bifida, verified by mouse mutant model. Inhibitors: Gleevec, Sutent. OMIM: Two alternatively-spliced isoforms have been described.

Protein type: Membrane protein, integral; EC 2.7.10.1; Kinase, protein; Oncoprotein; Protein kinase, tyrosine (receptor); Protein kinase, TK; TK group; PDGFR family

Chromosomal Location of Human Ortholog: 4q12

Cellular Component: microvillus; membrane; integral to plasma membrane; cytoplasm; plasma membrane; nucleus; intrinsic to plasma membrane; external side of plasma membrane

Molecular Function: vascular endothelial growth factor receptor activity; protein binding; protein homodimerization activity; platelet-derived growth factor binding; platelet-derived growth factor receptor binding; platelet-derived growth factor alpha-receptor activity; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: estrogen metabolic process; extracellular matrix organization and biogenesis; regulation of chemotaxis; peptidyl-tyrosine phosphorylation; wound healing; nerve growth factor receptor signaling pathway; viral reproduction; protein amino acid autophosphorylation; platelet-derived growth factor receptor signaling pathway; cardiac myofibril assembly; palate development; elevation of cytosolic calcium ion concentration; positive regulation of fibroblast proliferation; Leydig cell differentiation; embryonic digestive tract morphogenesis; luteinization; positive regulation of cell proliferation; male genitalia development; epidermal growth factor receptor signaling pathway; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; adrenal gland development; in utero embryonic development; positive regulation of phosphoinositide 3-kinase activity; embryonic cranial skeleton morphogenesis; embryonic skeletal morphogenesis; odontogenesis of dentine-containing teeth; positive regulation of phosphoinositide 3-kinase cascade; cell activation; innate immune response; hemopoietic progenitor cell differentiation; positive regulation of DNA replication; positive regulation of cell migration; lung development

Disease: Gastrointestinal Stromal Tumor; Hypereosinophilic Syndrome, Idiopathic

Research Articles on PDGFRA

Similar Products

Product Notes

The PDGFRA pdgfra (Catalog #AAA6154065) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDGFRA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDGFRA pdgfra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDGFRA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.