Western Blot (WB)
(Western Blot detection against Immunogen (46.02kD).)
Mouse anti-Human PDAP1 Monoclonal Antibody | anti-PDAP1 antibody
PDAP1 (28kD Heat-and Acid-stable Phosphoprotein, PDGF-associated Protein, PAP, PDGFA-associated Protein 1, PAP1, HASPP28) (FITC)
Gene Names
PDAP1; PAP; PAP1; HASPP28
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
PDAP1; Monoclonal Antibody; PDAP1 (28kD Heat-and Acid-stable Phosphoprotein; PDGF-associated Protein; PAP; PDGFA-associated Protein 1; PAP1; HASPP28) (FITC); anti-PDAP1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B10
Specificity
Recognizes human PDAP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PDAP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-181 from PDAP1 (AAH00684) with GST tag. *MW of the GST tag alone is 26kD.
Immunogen Sequence
MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (46.02kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (46.02kD).)
Western Blot (WB)
(Western Blot analysis of PDAP1 expression in transfected 293T cell line by 131027. Lane 1: PDAP1 transfected lysate (Predicted MW: 20.6kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PDAP1 expression in transfected 293T cell line by 131027. Lane 1: PDAP1 transfected lysate (Predicted MW: 20.6kD). Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged PDAP1 is 0.3ng/ml using 131027.)
Testing Data
(Detection limit for recombinant GST tagged PDAP1 is 0.3ng/ml using 131027.)
Related Product Information for anti-PDAP1 antibody
Human PDAP1 encodes a deduced 181aa protein expressed in all tissues test with the exception of liver, most abundantly in brain. PDAP1 enhances PDGFA-stimulated cell growth in mouse fibroblasts, but inhibits the mitogenic effect of PDGFB. The binding between PDGFA and PDAP1 is a low affinity/high capacity interaction, as determined by sold-phase studies.
Product Categories/Family for anti-PDAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
20,630 Da
NCBI Official Full Name
Homo sapiens PDGFA associated protein 1, mRNA
NCBI Official Synonym Full Names
PDGFA associated protein 1
NCBI Official Symbol
PDAP1
NCBI Official Synonym Symbols
PAP; PAP1; HASPP28
NCBI Protein Information
28 kDa heat- and acid-stable phosphoprotein
Protein Family
NCBI Description
The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. [provided by RefSeq, Dec 2010]
Similar Products
Product Notes
The PDAP1 (Catalog #AAA6148748) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDAP1 (28kD Heat-and Acid-stable Phosphoprotein, PDGF-associated Protein, PAP, PDGFA-associated Protein 1, PAP1, HASPP28) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDAP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
