Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PCSK6 Monoclonal Antibody | anti-PCSK6 antibody

PCSK6 (PACE4, Proprotein Convertase Subtilisin/Kexin Type 6, Paired Basic Amino Acid Cleaving Enzyme 4, Subtilisin-like Proprotein Convertase 4, SPC4, Subtilisin/Kexin-like Protease PACE4) (MaxLight 650)

Gene Names
PCSK6; SPC4; PACE4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCSK6; Monoclonal Antibody; PCSK6 (PACE4; Proprotein Convertase Subtilisin/Kexin Type 6; Paired Basic Amino Acid Cleaving Enzyme 4; Subtilisin-like Proprotein Convertase 4; SPC4; Subtilisin/Kexin-like Protease PACE4) (MaxLight 650); anti-PCSK6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D6
Specificity
Recognizes human PCSK6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
969
Applicable Applications for anti-PCSK6 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa860-970 from human PCSK6 (NP_002561) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PCSK6 antibody
PACE4 is a Serine S8 type protease that cleaves precursor proteins at paired basic amino acid processing sites. Several PACE4 substrates have been identified, including transforming growth factor beta-related proteins, proalbumin and von Willebrand factor. At least eight alternatively spliced transcript variants encoding different isoforms have been reported. In mouse, PACE4 has been shown to increase tumor cell invasiveness, and thus enhance tumor progression.
Product Categories/Family for anti-PCSK6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
proprotein convertase subtilisin/kexin type 6 isoform PACE4-AI preproprotein
NCBI Official Synonym Full Names
proprotein convertase subtilisin/kexin type 6
NCBI Official Symbol
PCSK6
NCBI Official Synonym Symbols
SPC4; PACE4
NCBI Protein Information
proprotein convertase subtilisin/kexin type 6
UniProt Protein Name
Proprotein convertase subtilisin/kexin type 6
UniProt Gene Name
PCSK6
UniProt Synonym Gene Names
PACE4; SPC4
UniProt Entry Name
PCSK6_HUMAN

NCBI Description

This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Feb 2014]

Uniprot Description

PCSK6: Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif. Belongs to the peptidase S8 family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Protease; Secreted, signal peptide; EC 3.4.21.-

Chromosomal Location of Human Ortholog: 15q26.3

Cellular Component: cell surface; endoplasmic reticulum; extracellular matrix; extracellular space; Golgi lumen; membrane

Molecular Function: endopeptidase activity; heparin binding; nerve growth factor binding; serine-type endopeptidase activity

Biological Process: determination of left/right symmetry; glycoprotein metabolic process; nerve growth factor processing; nerve growth factor production; peptide hormone processing; protein processing; regulation of BMP signaling pathway; secretion by cell; zygotic determination of anterior/posterior axis, embryo

Research Articles on PCSK6

Similar Products

Product Notes

The PCSK6 pcsk6 (Catalog #AAA6223724) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCSK6 (PACE4, Proprotein Convertase Subtilisin/Kexin Type 6, Paired Basic Amino Acid Cleaving Enzyme 4, Subtilisin-like Proprotein Convertase 4, SPC4, Subtilisin/Kexin-like Protease PACE4) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCSK6 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCSK6 pcsk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCSK6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.