Mouse anti-Human PCSK6 Monoclonal Antibody | anti-PCSK6 antibody

PCSK6 (PACE4, Proprotein Convertase Subtilisin/Kexin Type 6, Paired Basic Amino Acid Cleaving Enzyme 4, Subtilisin-like Proprotein Convertase 4, SPC4, Subtilisin/Kexin-like Protease PACE4) APC

Cat. Num. AAA6138138

• Gene Names: PCSK6; SPC4; PACE4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PCSK6; Monoclonal Antibody; PCSK6 (PACE4; Proprotein Convertase Subtilisin/Kexin Type 6; Paired Basic Amino Acid Cleaving Enzyme 4; Subtilisin-like Proprotein Convertase 4; SPC4; Subtilisin/Kexin-like Protease PACE4) APC; anti-PCSK6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D6
• Specificity: Recognizes human PCSK6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 969

• Applicable Applications for anti-PCSK6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa860-970 from human PCSK6 (NP_002561) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged PCSK6 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-PCSK6 antibody

PACE4 is a Serine S8 type protease that cleaves precursor proteins at paired basic amino acid processing sites. Several PACE4 substrates have been identified, including transforming growth factor beta-related proteins, proalbumin and von Willebrand factor. At least eight alternatively spliced transcript variants encoding different isoforms have been reported. In mouse, PACE4 has been shown to increase tumor cell invasiveness, and thus enhance tumor progression.

Product Categories/Family for anti-PCSK6 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 4505577
• NCBI GeneID: 5046
• NCBI Accession #: NP_002561
• NCBI GenBank Nucleotide #: NM_002570
• UniProt Accession #: P29122
• NCBI Official Full Name: proprotein convertase subtilisin/kexin type 6 isoform PACE4-AI preproprotein
• NCBI Official Synonym Full Names: proprotein convertase subtilisin/kexin type 6
• NCBI Official Symbol: PCSK6
• NCBI Official Synonym Symbols: SPC4; PACE4
• NCBI Protein Information: proprotein convertase subtilisin/kexin type 6
• UniProt Protein Name: Proprotein convertase subtilisin/kexin type 6
• Protein Family: Proprotein convertase subtilisin/kexin
• UniProt Gene Name: PCSK6
• UniProt Synonym Gene Names: PACE4; SPC4
• UniProt Entry Name: PCSK6_HUMAN

NCBI Description

This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Feb 2014]

Uniprot Description

PCSK6: Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif. Belongs to the peptidase S8 family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Protease; Secreted, signal peptide; EC 3.4.21.-

Chromosomal Location of Human Ortholog: 15q26.3

Cellular Component: cell surface; endoplasmic reticulum; extracellular matrix; extracellular space; Golgi lumen; membrane

Molecular Function: endopeptidase activity; heparin binding; nerve growth factor binding; serine-type endopeptidase activity

Biological Process: determination of left/right symmetry; glycoprotein metabolic process; nerve growth factor processing; nerve growth factor production; peptide hormone processing; protein processing; regulation of BMP signaling pathway; secretion by cell; zygotic determination of anterior/posterior axis, embryo