Testing Data
(Detection limit for recombinant GST tagged PCP4 is ~1ng/ml using MBS644924 as a capture antibody.)
Mouse anti-Human PCP4 Monoclonal Antibody | anti-PCP4 antibody
PCP4 (Purkinje Cell Protein 4, Brain-specific Antigen PCP-4, Brain-specific Polypeptide PEP-19, PEP19)
Gene Names
PCP4; PEP-19
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PCP4; Monoclonal Antibody; PCP4 (Purkinje Cell Protein 4; Brain-specific Antigen PCP-4; Brain-specific Polypeptide PEP-19; PEP19); Anti -PCP4 (Purkinje Cell Protein 4; anti-PCP4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E3
Specificity
Recognizes human PCP4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Applicable Applications for anti-PCP4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-63 from human PCP4 (NP_006189) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PCP4 is ~1ng/ml using MBS644924 as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PCP4 is ~1ng/ml using MBS644924 as a capture antibody.)
Western Blot (WB)
(Western Blot detection against Immunogen using MBS644924 (32.56kD).)
Western Blot (WB)
(Western Blot detection against Immunogen using MBS644924 (32.56kD).)
Related Product Information for anti-PCP4 antibody
Probable regulator of calmodulin signaling.
Product Categories/Family for anti-PCP4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
6,791 Da
NCBI Official Full Name
Purkinje cell protein 4
NCBI Official Synonym Full Names
Purkinje cell protein 4
NCBI Official Symbol
PCP4
NCBI Official Synonym Symbols
PEP-19
NCBI Protein Information
Purkinje cell protein 4; brain-specific antigen PCP-4; brain specific polypeptide PEP19; brain-specific polypeptide PEP-19
UniProt Protein Name
Purkinje cell protein 4
Protein Family
UniProt Gene Name
PCP4
UniProt Synonym Gene Names
PEP19
UniProt Entry Name
PCP4_HUMAN
Uniprot Description
PCP4: Probable regulator of calmodulin signaling. Belongs to the PCP4 family.
Protein type: Calcium-binding; Cell development/differentiation
Chromosomal Location of Human Ortholog: 21q22.2
Cellular Component: cytosol; nucleus
Molecular Function: calmodulin binding
Biological Process: central nervous system development
Research Articles on PCP4
Similar Products
Product Notes
The PCP4 pcp4 (Catalog #AAA644924) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCP4 (Purkinje Cell Protein 4, Brain-specific Antigen PCP-4, Brain-specific Polypeptide PEP-19, PEP19) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCP4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PCP4 pcp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSERQGAGAT NGKDKTSGEN DGQKKVQEEF DIDMDAPETE RAAVAIQSQF RKFQKKKAGS QS. It is sometimes possible for the material contained within the vial of "PCP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
