Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Mouse anti-Human PCGF5 Monoclonal Antibody | anti-PCGF5 antibody
PCGF5 (Polycomb Group RING Finger Protein 5, RING Finger Protein 159, RNF159, MGC16202) (HRP)
Gene Names
PCGF5; RNF159
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCGF5; Monoclonal Antibody; PCGF5 (Polycomb Group RING Finger Protein 5; RING Finger Protein 159; RNF159; MGC16202) (HRP); anti-PCGF5 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C10
Specificity
Recognizes human PCGF5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
256
Applicable Applications for anti-PCGF5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa51-149 from human PCGF5 (NP_115749) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NDCPRCGNQVHETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVDEEGDENEDDKDYHRSDPQIAICLDCLRN
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Western Blot (WB)
(Western Blot analysis of PCGF5 expression in transfected 293T cell line by PCGF5 monoclonal antibody. Lane 1: PCGF5 transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PCGF5 expression in transfected 293T cell line by PCGF5 monoclonal antibody. Lane 1: PCGF5 transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PCGF5 antibody
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
Product Categories/Family for anti-PCGF5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
polycomb group RING finger protein 5
NCBI Official Synonym Full Names
polycomb group ring finger 5
NCBI Official Symbol
PCGF5
NCBI Official Synonym Symbols
RNF159
NCBI Protein Information
polycomb group RING finger protein 5
UniProt Protein Name
Polycomb group RING finger protein 5
Protein Family
UniProt Gene Name
PCGF5
UniProt Synonym Gene Names
RNF159
Uniprot Description
PCGF5: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: 10q23.32
Cellular Component: centrosome; nucleolus; nucleus; PcG protein complex; X chromosome
Molecular Function: metal ion binding; protein binding
Biological Process: positive regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent
Research Articles on PCGF5
Similar Products
Product Notes
The PCGF5 pcgf5 (Catalog #AAA6154035) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCGF5 (Polycomb Group RING Finger Protein 5, RING Finger Protein 159, RNF159, MGC16202) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCGF5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCGF5 pcgf5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCGF5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
