Mouse anti-Human PCDHA1 Monoclonal Antibody | anti-PCDHA1 antibody

PCDHA1 (Protocadherin alpha-1, PCDH-alpha-1) APC

Cat. Num. AAA6138099

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PCDHA1; Monoclonal Antibody; PCDHA1 (Protocadherin alpha-1; PCDH-alpha-1) APC; anti-PCDHA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3A3
• Specificity: Recognizes human PCDHA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 950

• Applicable Applications for anti-PCDHA1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa243-333 from human PCDHA1 (NP_061723) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DQAVYRVHLLETTANGTLVTTLNASDADEGVNGEVVFSFDSGISRDIQEKFKVDSSSGEIRLIDKLDYEETKSYEIQVKAVDKGSPPMSN
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Related Product Information for anti-PCDHA1 antibody

This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Product Categories/Family for anti-PCDHA1 antibody

Antibodies; Cadherin

NCBI and Uniprot Product Information

• NCBI GI #: 9256582
• NCBI Accession #: NP_061723
• NCBI GenBank Nucleotide #: NM_018900
• UniProt Accession #: Q9Y5I3
• NCBI Official Full Name: protocadherin alpha-1 isoform 1
• UniProt Protein Name: Protocadherin alpha-1
• Protein Family: Protocadherin
• UniProt Gene Name: PCDHA1
• UniProt Synonym Gene Names: PCDH-alpha-1

Uniprot Description

PCDHA1: Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 5q31.3

Cellular Component: endoplasmic reticulum; extracellular region; integral component of plasma membrane

Molecular Function: calcium ion binding

Biological Process: cell adhesion; cell-cell signaling; homophilic cell adhesion; nervous system development