Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.08kD).)

Mouse anti-Human PCDH7 Monoclonal Antibody | anti-PCDH7 antibody

PCDH7 (BHPCDH, Protocadherin-7, Brain-heart Protocadherin, BH-Pcdh) APC

Gene Names
PCDH7; BHPCDH; BH-Pcdh; PPP1R120
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCDH7; Monoclonal Antibody; PCDH7 (BHPCDH; Protocadherin-7; Brain-heart Protocadherin; BH-Pcdh) APC; anti-PCDH7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D7
Specificity
Recognizes human PCDH7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1069
Applicable Applications for anti-PCDH7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa31-125 from human PCDH7 (NP_002580) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.08kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.08kD).)

Testing Data

(Detection limit for recombinant GST tagged PCDH7 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PCDH7 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-PCDH7 antibody
This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes a protein with an extracellular domain containing 7 cadherin repeats. The gene product is an integral membrane protein that is thought to function in cell-cell recognition and adhesion. Alternative splicing yields isoforms with unique cytoplasmic tails. [provided by RefSeq].
Product Categories/Family for anti-PCDH7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protocadherin-7 isoform a
NCBI Official Synonym Full Names
protocadherin 7
NCBI Official Symbol
PCDH7
NCBI Official Synonym Symbols
BHPCDH; BH-Pcdh; PPP1R120
NCBI Protein Information
protocadherin-7
UniProt Protein Name
Protocadherin-7
Protein Family
UniProt Gene Name
PCDH7
UniProt Synonym Gene Names
BHPCDH; BH-Pcdh
UniProt Entry Name
PCDH7_HUMAN

NCBI Description

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes a protein with an extracellular domain containing 7 cadherin repeats. The gene product is an integral membrane protein that is thought to function in cell-cell recognition and adhesion. Alternative splicing yields isoforms with unique cytoplasmic tails. [provided by RefSeq, Jul 2008]

Uniprot Description

Subcellular location: Cell membrane; Single-pass type I membrane protein.

Tissue specificity: Expressed predominantly in brain and heart and at lower levels in various other tissues.

Sequence similarities: Contains 7 cadherin domains.

Research Articles on PCDH7

Similar Products

Product Notes

The PCDH7 pcdh7 (Catalog #AAA6138097) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCDH7 (BHPCDH, Protocadherin-7, Brain-heart Protocadherin, BH-Pcdh) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCDH7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCDH7 pcdh7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCDH7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.