CD84 recombinant protein

CD84 Recombinant Protein

Cat. Num. AAA3016016

• Gene Names: CD84; LY9B; hCD84; mCD84; SLAMF5
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Synonyms: CD84; CD84 Recombinant Protein; CD84 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Sequence: KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTG

• Restriction Site: NdeI-XhoI
• Expression Vector: pet-22b(+)
• Preparation and Storage: Store at 4 degree C short term. Aliquot and store at -20 degree C long term. Avoid freeze-thaw cycles.

Testing Data

Related Product Information for CD84 recombinant protein

The human CD84 gene maps to chromosome 1q23.3 and is composed of at least eight exons, with an exon coding for the 5' UTR and the leader peptide, two exons coding for each of the two extracellular Ig-like domains, an exon encoding the hydrophobic transmembrane region and four exons coding for the cytoplasmic domains. The extracellular Ig-like domains share structural and sequence homology with a group of members of the Ig superfamily that include CD2, CD48, CD58 and Ly9. Five CD84 isoforms have been characterized, including CD84a, CD84b, CD84c, CD84d and CD84e, which are preferentially expressed on B lymphocytes, monocytes and platelets, where they act as their own ligand and are therefore costimulatory molecules. The CD84 isoforms are generated by alternative exon enhancement, reading frame shift and use of cryptic splice sites. The differential expression of potential sites of phosphorylation on the different isoforms may be a way to regulate CD84 activity in signal transduction.

NCBI and Uniprot Product Information

• NCBI GI #: 296434285
• NCBI GeneID: 8832
• NCBI Accession #: NP_001171808.1
• NCBI GenBank Nucleotide #: NM_001184879.1
• UniProt Accession #: Q9UIB8; O15430; O95266; O95660; Q5H9R1; Q6FHA8; Q8WLP1; Q8WWI8; Q9UF04; Q9UIB6; B2R8T1; B7Z3R8
• Molecular Weight: 24,025 Da
• NCBI Official Full Name: SLAM family member 5 isoform 1
• NCBI Official Synonym Full Names: CD84 molecule
• NCBI Official Symbol: CD84
• NCBI Official Synonym Symbols: LY9B; hCD84; mCD84; SLAMF5
• NCBI Protein Information: SLAM family member 5; CD84 antigen (leukocyte antigen); cell surface antigen MAX.3; hly9-beta; leucocyte differentiation antigen CD84; leukocyte antigen CD84; leukocyte differentiation antigen CD84; signaling lymphocytic activation molecule 5
• UniProt Protein Name: SLAM family member 5
• Protein Family: SLAM family
• UniProt Gene Name: CD84
• UniProt Synonym Gene Names: SLAMF5
• UniProt Entry Name: SLAF5_HUMAN

NCBI Description

This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]

Uniprot Description

CD84: Plays a role as adhesion receptor functioning by homophilic interactions and by clustering. Recruits SH2 domain- containing proteins SH2D1A/SAP. Increases proliferative responses of activated T-cells and SH2D1A/SAP does not seen be required for this process. Homophilic interactions enhance interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A/SAP-dependent pathway. May serve as a marker for hematopoietic progenitor cells. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Immunoglobulin superfamily; Cell surface; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q24

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding; receptor activity

Biological Process: defense response; homophilic cell adhesion; blood coagulation; leukocyte migration