Western Blot (WB)
(Host: RabbitTarget Name: ZSC12Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human ZSCAN12 Polyclonal Antibody | anti-ZSCAN12 antibody
ZSCAN12 Antibody - N-terminal region
Gene Names
ZSCAN12; ZFP96; ZNF96; ZNF305; ZNF29K1; dJ29K1.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ZSCAN12; Polyclonal Antibody; ZSCAN12 Antibody - N-terminal region; anti-ZSCAN12 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGPREALSR
Sequence Length
604
Applicable Applications for anti-ZSCAN12 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ZSC12Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ZSC12Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZSCAN12 antibody
This is a rabbit polyclonal antibody against ZSC12. It was validated on Western Blot
Product Categories/Family for anti-ZSCAN12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Synonym Full Names
zinc finger and SCAN domain containing 12
NCBI Official Symbol
ZSCAN12
NCBI Official Synonym Symbols
ZFP96; ZNF96; ZNF305; ZNF29K1; dJ29K1.2
NCBI Protein Information
zinc finger and SCAN domain-containing protein 12
UniProt Protein Name
Zinc finger and SCAN domain-containing protein 12
Protein Family
UniProt Gene Name
ZSCAN12
UniProt Synonym Gene Names
KIAA0426; ZNF305; ZNF96
UniProt Entry Name
ZSC12_HUMAN
Uniprot Description
ZSCAN12: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.
Protein type: Transcription factor; C2H2-type zinc finger protein; DNA-binding
Chromosomal Location of Human Ortholog: 6p21
Cellular Component: nucleus
Molecular Function: DNA binding; metal ion binding; transcription factor activity
Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent
Similar Products
Product Notes
The ZSCAN12 zscan12 (Catalog #AAA3204453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZSCAN12 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZSCAN12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZSCAN12 zscan12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEVKIEEEKY TTRQDWDLRK NNTHSREVFR QYFRQFCYQE TSGPREALSR. It is sometimes possible for the material contained within the vial of "ZSCAN12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
