Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PCAF monoclonal antibody (M13), clone 1E3. Western Blot analysis of PCAF expression in MES-SA/Dx5 (Cat # L021V1).)

Mouse PCAF Monoclonal Antibody | anti-PCAF antibody

PCAF (K(Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (PE)

Gene Names
KAT2B; CAF; PCAF; P/CAF
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
PCAF; Monoclonal Antibody; PCAF (K(Lysine) Acetyltransferase 2B; CAF; P; P/CAF; PCAF) (PE); K(Lysine) Acetyltransferase 2B; anti-PCAF antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1000
Specificity
Recognizes PCAF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PCAF antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PCAF (NP_003875, 367aa-432aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PCAF monoclonal antibody (M13), clone 1E3. Western Blot analysis of PCAF expression in MES-SA/Dx5 (Cat # L021V1).)

Western Blot (WB) (PCAF monoclonal antibody (M13), clone 1E3. Western Blot analysis of PCAF expression in MES-SA/Dx5 (Cat # L021V1).)
Related Product Information for anti-PCAF antibody
CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. [provided by RefSeq]
Product Categories/Family for anti-PCAF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93,013 Da
NCBI Official Full Name
histone acetyltransferase KAT2B
NCBI Official Synonym Full Names
K(lysine) acetyltransferase 2B
NCBI Official Symbol
KAT2B
NCBI Official Synonym Symbols
CAF; PCAF; P/CAF
NCBI Protein Information
histone acetyltransferase KAT2B; CREBBP-associated factor; histone acetylase PCAF; histone acetyltransferase PCAF; lysine acetyltransferase 2B; p300/CBP-associated factor
UniProt Protein Name
Histone acetyltransferase KAT2B
UniProt Gene Name
KAT2B
UniProt Synonym Gene Names
PCAF; Histone acetylase PCAF; P/CAF
UniProt Entry Name
KAT2B_HUMAN

Uniprot Description

PCAF: Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles. Inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Interacts with SIRT1. Interacts (unsumoylated form) with NR2C1; the interaction promotes transactivation activity. Interacts with EP300, CREBBP and DDX17. Interacts with NCOA1 and NCOA3. Component of a large chromatin remodeling complex, at least composed of MYSM1, KAT2B/PCAF, RBM10 and KIF11/TRIP5. Interacts with NR2C2 (hypophosphorylated and unsumoylated form); the interaction promotes the transactivation activity of NR2C2. Binds to HTLV-1 Tax. Interacts with and acetylates HIV-1 Tat. Interacts with KLF1; the interaction does not acetylate KLF1 and there is no enhancement of its transactivational activity. Interacts with NFE4. Interacts with MECOM. Interacts with E2F1; the interaction acetylates E2F1 augmenting its DNA-binding and transcriptional activity. Ubiquitously expressed but most abundant in heart and skeletal muscle. Belongs to the GCN5 family.

Protein type: Acetyltransferase; Nuclear receptor co-regulator; EC 2.3.1.48

Chromosomal Location of Human Ortholog: 3p24

Cellular Component: kinetochore; nucleoplasm; I band; PCAF complex; actomyosin; nucleus; A band

Molecular Function: lysine N-acetyltransferase activity; cyclin-dependent protein kinase inhibitor activity; protein binding; histone acetyltransferase activity; histone deacetylase binding; transcription coactivator activity; acetyltransferase activity; protein complex binding; transcription cofactor activity; transcription factor binding; protein kinase binding

Biological Process: transcription initiation from RNA polymerase II promoter; Notch signaling pathway; establishment and/or maintenance of chromatin architecture; internal peptidyl-lysine acetylation; viral reproduction; negative regulation of cyclin-dependent protein kinase activity; rhythmic process; transcription from RNA polymerase I promoter; chromatin remodeling; negative regulation of cell proliferation; protein amino acid acetylation; cellular response to insulin stimulus; gene expression; positive regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase I promoter; cell cycle arrest; peptidyl-lysine acetylation; N-terminal peptidyl-lysine acetylation

Similar Products

Product Notes

The PCAF kat2b (Catalog #AAA6186508) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PCAF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCAF kat2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCAF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.