Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.21kD).)

Mouse anti-Human KLF9 Monoclonal Antibody | anti-KLF9 antibody

KLF9 (Krueppel-like Factor 9, Basic Transcription Element-binding Protein 1, BTE-binding Protein 1, GC-box-binding Protein 1, Transcription Factor BTEB1, BTEB, BTEB1) (AP)

Gene Names
KLF9; BTEB; BTEB1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLF9; Monoclonal Antibody; KLF9 (Krueppel-like Factor 9; Basic Transcription Element-binding Protein 1; BTE-binding Protein 1; GC-box-binding Protein 1; Transcription Factor BTEB1; BTEB; BTEB1) (AP); anti-KLF9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H5
Specificity
Recognizes human KLF9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-KLF9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa25-101 from human KLF9 (NP_001197) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.21kD).)

Testing Data

(Detection limit for recombinant GST tagged KLF9 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KLF9 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-KLF9 antibody
Transcription factor that binds to GC box promoter elements. Selectively activates mRNA synthesis from genes containing tandem repeats of GC boxes but represses genes with a single GC box.
Product Categories/Family for anti-KLF9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
687
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
Krueppel-like factor 9
NCBI Official Synonym Full Names
Kruppel like factor 9
NCBI Official Symbol
KLF9
NCBI Official Synonym Symbols
BTEB; BTEB1
NCBI Protein Information
Krueppel-like factor 9
UniProt Protein Name
Krueppel-like factor 9
Protein Family
UniProt Gene Name
KLF9
UniProt Synonym Gene Names
BTEB; BTEB1; BTE-binding protein 1
UniProt Entry Name
KLF9_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription. [provided by RefSeq, Jul 2008]

Uniprot Description

KLF9: Transcription factor that binds to GC box promoter elements. Selectively activates mRNA synthesis from genes containing tandem repeats of GC boxes but represses genes with a single GC box. Belongs to the Sp1 C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 9q13

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; circadian rhythm; progesterone receptor signaling pathway; transcription, DNA-dependent; embryo implantation

Research Articles on KLF9

Similar Products

Product Notes

The KLF9 klf9 (Catalog #AAA6132012) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KLF9 (Krueppel-like Factor 9, Basic Transcription Element-binding Protein 1, BTE-binding Protein 1, GC-box-binding Protein 1, Transcription Factor BTEB1, BTEB, BTEB1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLF9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLF9 klf9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.