Mouse PBK Monoclonal Antibody | anti-PBK antibody

PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (APC)

Cat. Num. AAA6166995

• Gene Names: PBK; SPK; CT84; TOPK; Nori-3
• Applications: Immunofluorescence
• Purity: Purified
• Synonyms: PBK; Monoclonal Antibody; PBK (PDZ Binding Kinase; FLJ14385; Nori-3; SPK; TOPK) (APC); PDZ Binding Kinase; TOPK; anti-PBK antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2D2
• Specificity: Recognizes PBK.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-PBK antibody: Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PBK (NP_060962.2, 122aa-229aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKAD
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PBK is 0.1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-PBK antibody

This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq]

Product Categories/Family for anti-PBK antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 18490991
• NCBI GeneID: 55872
• NCBI Accession #: NP_060962.2
• NCBI GenBank Nucleotide #: NM_018492.2
• UniProt Accession #: Q96KB5; Q9NPD9; Q9NYL7; Q9NZK6; D3DST2
• Molecular Weight: 36,085 Da
• NCBI Official Full Name: lymphokine-activated killer T-cell-originated protein kinase
• NCBI Official Synonym Full Names: PDZ binding kinase
• NCBI Official Symbol: PBK
• NCBI Official Synonym Symbols: SPK; CT84; TOPK; Nori-3
• NCBI Protein Information: lymphokine-activated killer T-cell-originated protein kinase; PDZ-binding kinase; cancer/testis antigen 84; MAPKK-like protein kinase; serine/threonine protein kinase; T-LAK cell-originated protein kinase; spermatogenesis-related protein kinase
• UniProt Protein Name: Lymphokine-activated killer T-cell-originated protein kinase
• Protein Family: Lymphokine-activated killer T-cell-originated protein kinase
• UniProt Gene Name: PBK
• UniProt Synonym Gene Names: TOPK; CT84; SPK
• UniProt Entry Name: TOPK_HUMAN

NCBI Description

This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

PBK: Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage. Interacts with DLG1 and TP53. Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules. Activated by phosphorylation. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase kinase subfamily.

Protein type: Protein kinase, Other; Cancer Testis Antigen (CTA); Protein kinase, Ser/Thr (non-receptor); EC 2.7.12.2; Kinase, protein; Other group; TOPK family

Chromosomal Location of Human Ortholog: 8p21.2

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: mitosis; negative regulation of protein amino acid phosphorylation; negative regulation of inflammatory response; negative regulation of stress-activated MAPK cascade; protein amino acid phosphorylation; negative regulation of proteasomal ubiquitin-dependent protein catabolic process