Mouse PAX8 Monoclonal Antibody | anti-PAX8 antibody

PAX8 (Paired Box 8) (FITC)

Cat. Num. AAA6176261

• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: PAX8; Monoclonal Antibody; PAX8 (Paired Box 8) (FITC); Paired Box 8; anti-PAX8 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A6
• Specificity: Recognizes PAX8.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 450

• Applicable Applications for anti-PAX8 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PAX8 (AAH01060, 1aa-450aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PAX8 expression in transfected 293T cell line by PAX8 monoclonal antibody (M07), clone 1A6.Lane 1: PAX8 transfected lysate (48.119 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PAX8 is approximately 3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAX8 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAX8 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-PAX8 antibody

This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternateively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Product Categories/Family for anti-PAX8 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 12654465
• NCBI GeneID: 7849
• NCBI Official Full Name: Paired box 8
• NCBI Official Synonym Full Names: paired box 8
• NCBI Official Symbol: PAX8
• NCBI Protein Information: paired box protein Pax-8
• Protein Family: Paired box protein

NCBI Description

This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010]