Mouse anti-Human PAX3 Monoclonal Antibody | anti-PAX3 antibody

PAX3 (Paired Box Protein Pax-3, HuP2, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778) (HRP)

Cat. Num. AAA6153987

• Gene Names: PAX3; WS1; WS3; CDHS; HUP2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAX3; Monoclonal Antibody; PAX3 (Paired Box Protein Pax-3; HuP2; HUP2; MGC120381; MGC120382; MGC120383; MGC120384; MGC134778) (HRP); anti-PAX3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4F4
• Specificity: Recognizes human PAX3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PAX3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Recombinant corresponding to aa307-414 from human PAX3 (NP_852122) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Related Product Information for anti-PAX3 antibody

Probable transcription factor associated with development of alveolar rhabdomyosarcoma.

Product Categories/Family for anti-PAX3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 31563340
• NCBI GeneID: 5077
• NCBI Accession #: NP_852122
• NCBI GenBank Nucleotide #: NM_181457
• UniProt Accession #: P23760
• Molecular Weight: 53kDa
• NCBI Official Full Name: paired box protein Pax-3 isoform PAX3
• NCBI Official Synonym Full Names: paired box 3
• NCBI Official Symbol: PAX3
• NCBI Official Synonym Symbols: WS1; WS3; CDHS; HUP2
• NCBI Protein Information: paired box protein Pax-3
• UniProt Protein Name: Paired box protein Pax-3
• Protein Family: Paired box protein
• UniProt Gene Name: PAX3
• UniProt Synonym Gene Names: HUP2
• UniProt Entry Name: PAX3_HUMAN

NCBI Description

This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini. [provided by RefSeq, Jul 2008]

Uniprot Description

PAX3: Probable transcription factor associated with development of alveolar rhabdomyosarcoma. Can bind to DNA as a heterodimer with PAX7. Interacts with DAXX. Belongs to the paired homeobox family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Oncoprotein; DNA-binding

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; muscle development; apoptosis; heart development; positive regulation of transcription, DNA-dependent; pigmentation during development; neuron fate commitment; negative regulation of transcription from RNA polymerase II promoter; cell proliferation; organ morphogenesis; sensory perception of sound; positive regulation of cell proliferation; neural tube closure; spinal cord association neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; regulation of somitogenesis; neural crest cell migration

Disease: Waardenburg Syndrome, Type 3; Craniofacial-deafness-hand Syndrome; Rhabdomyosarcoma 2; Waardenburg Syndrome, Type 1