Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Mouse anti-Human PAX3 Monoclonal Antibody | anti-PAX3 antibody

PAX3 (Paired Box Protein Pax-3, HuP2, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778) (PE)

Gene Names
PAX3; WS1; WS3; CDHS; HUP2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAX3; Monoclonal Antibody; PAX3 (Paired Box Protein Pax-3; HuP2; HUP2; MGC120381; MGC120382; MGC120383; MGC120384; MGC134778) (PE); anti-PAX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F4
Specificity
Recognizes human PAX3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PAX3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant corresponding to aa307-414 from human PAX3 (NP_852122) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)
Related Product Information for anti-PAX3 antibody
Probable transcription factor associated with development of alveolar rhabdomyosarcoma.
Product Categories/Family for anti-PAX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
paired box protein Pax-3 isoform PAX3
NCBI Official Synonym Full Names
paired box 3
NCBI Official Symbol
PAX3
NCBI Official Synonym Symbols
WS1; WS3; CDHS; HUP2
NCBI Protein Information
paired box protein Pax-3
UniProt Protein Name
Paired box protein Pax-3
Protein Family
UniProt Gene Name
PAX3
UniProt Synonym Gene Names
HUP2
UniProt Entry Name
PAX3_HUMAN

NCBI Description

This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini. [provided by RefSeq, Jul 2008]

Uniprot Description

PAX3: Probable transcription factor associated with development of alveolar rhabdomyosarcoma. Can bind to DNA as a heterodimer with PAX7. Interacts with DAXX. Belongs to the paired homeobox family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Oncoprotein; DNA-binding

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; muscle development; apoptosis; heart development; positive regulation of transcription, DNA-dependent; pigmentation during development; neuron fate commitment; negative regulation of transcription from RNA polymerase II promoter; cell proliferation; organ morphogenesis; sensory perception of sound; positive regulation of cell proliferation; neural tube closure; spinal cord association neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; regulation of somitogenesis; neural crest cell migration

Disease: Waardenburg Syndrome, Type 3; Craniofacial-deafness-hand Syndrome; Rhabdomyosarcoma 2; Waardenburg Syndrome, Type 1

Research Articles on PAX3

Similar Products

Product Notes

The PAX3 pax3 (Catalog #AAA6159290) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAX3 (Paired Box Protein Pax-3, HuP2, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAX3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAX3 pax3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.