Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PARL Monoclonal Antibody | anti-PARL antibody

PARL (Presenilins-associated Rhomboid-like Protein, Mitochondrial, Mitochondrial Intramembrane Cleaving Protease PARL, PSARL, PSARL1, PRO2207, PSENIP2, RHBDS1) (MaxLight 405)

Gene Names
PARL; PSARL; PSARL1; RHBDS1; PRO2207; PSENIP2
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PARL; Monoclonal Antibody; PARL (Presenilins-associated Rhomboid-like Protein; Mitochondrial; Mitochondrial Intramembrane Cleaving Protease PARL; PSARL; PSARL1; PRO2207; PSENIP2; RHBDS1) (MaxLight 405); EC=3.4.21.105; anti-PARL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F4
Specificity
Recognizes human PSARL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PARL antibody
FLISA
Application Notes
FLISA: 1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-101 from human PSARL (NP_061092) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIK
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PARL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,589 Da
NCBI Official Full Name
presenilins-associated rhomboid-like protein, mitochondrial isoform 1 preproprotein
NCBI Official Synonym Full Names
presenilin associated, rhomboid-like
NCBI Official Symbol
PARL
NCBI Official Synonym Symbols
PSARL; PSARL1; RHBDS1; PRO2207; PSENIP2
NCBI Protein Information
presenilins-associated rhomboid-like protein, mitochondrial; rhomboid 7 homolog 1; mitochondrial intramembrane cleaving protease PARL; mitochondrial intramembrane-cleaving protease PARL
UniProt Protein Name
Presenilins-associated rhomboid-like protein, mitochondrial
UniProt Gene Name
PARL
UniProt Synonym Gene Names
PSARL; Pbeta
UniProt Entry Name
PARL_HUMAN

NCBI Description

This gene encodes a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. This gene may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

PSARL: a mitochondrial intramembrane protease that is associated with insulin resistance and type 2 diabetes. Induced in humans by caloric restriction. Required for the control of apoptosis during postnatal growth. Essential for proteolytic processing of an antiapoptotic form of OPA1 which prevents the release of mitochondrial cytochrome c in response to intrinsic apoptotic signals. Promotes changes in mitochondria morphology regulated by phosphorylation of P-beta domain. Induced in humans by caloric restriction. Interacts with PSEN1 and PSEN2. Binds OPA1. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Membrane protein, integral; Protease; EC 3.4.21.105; Membrane protein, multi-pass; Mitochondrial

Chromosomal Location of Human Ortholog: 3q27.1

Cellular Component: mitochondrion; mitochondrial inner membrane; integral to membrane; nucleus

Molecular Function: protein binding; serine-type endopeptidase activity; endopeptidase activity

Biological Process: membrane protein proteolysis; proteolysis

Research Articles on PARL

Similar Products

Product Notes

The PARL parl (Catalog #AAA6192038) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PARL (Presenilins-associated Rhomboid-like Protein, Mitochondrial, Mitochondrial Intramembrane Cleaving Protease PARL, PSARL, PSARL1, PRO2207, PSENIP2, RHBDS1) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PARL can be used in a range of immunoassay formats including, but not limited to, FLISA. FLISA: 1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PARL parl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PARL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.