Mouse anti-Human, Mouse PAPSS2 Monoclonal Antibody | anti-PAPSS2 antibody

PAPSS2 (PAPS Synthase 2, PAPSS 2, 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, ATPSK2, Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, Sulfurylase Kinase 2, SK 2, SK2) (HRP)

Cat. Num. AAA6153972

• Gene Names: PAPSS2; SK2; BCYM4; ATPSK2
• Reactivity: Human, Mouse
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAPSS2; Monoclonal Antibody; PAPSS2 (PAPS Synthase 2; PAPSS 2; 3'-phosphoadenosine 5'-phosphosulfate Synthase 2; ATPSK2; Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 2; Sulfurylase Kinase 2; SK 2; SK2) (HRP); anti-PAPSS2 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A8
• Specificity: Recognizes human PAPSS2. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PAPSS2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa513-613 from PAPSS2 (NP_004661) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western blot analysis of PAPSS2 over-expressed 293 cell line, cotransfected with PAPSS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Detection limit for recombinant GST tagged PAPSS2 is ~0.03ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAPSS2 on A-431 cell. [antibody concentration 10ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Western Blot (WB)

(Western Blot analysis of PAPSS2 expression in transfected 293T cell line by PAPSS2 monoclonal antibody. Lane 1: PAPSS2 transfected lysate (69.5kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-PAPSS2 antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 34447231
• NCBI GeneID: 9060
• NCBI Accession #: NP_004661
• NCBI GenBank Nucleotide #: NM_004670
• UniProt Accession #: O95340
• Molecular Weight: 67kDa
• NCBI Official Full Name: bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 isoform a
• NCBI Official Synonym Full Names: 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• NCBI Official Symbol: PAPSS2
• NCBI Official Synonym Symbols: SK2; BCYM4; ATPSK2
• NCBI Protein Information: bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• UniProt Protein Name: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• Protein Family: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase
• UniProt Gene Name: PAPSS2
• UniProt Synonym Gene Names: ATPSK2; PAPS synthase 2; PAPSS 2; SK 2; SK2; SAT

NCBI Description

Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Bifunctional enzyme with both ATP sulfurylase and APS kinase activity, which mediates two steps in the sulfate activation pathway. The first step is the transfer of a sulfate group to ATP to yield adenosine 5'-phosphosulfate (APS), and the second step is the transfer of a phosphate group from ATP to APS yielding 3'-phosphoadenylylsulfate (PAPS: activated sulfate donor used by sulfotransferase). In mammals, PAPS is the sole source of sulfate; APS appears to be only an intermediate in the sulfate-activation pathway. May have a important role in skeletogenesis during postnatal growth ().