Mouse anti-Human PAI-RBP1 Monoclonal Antibody | anti-SERBP1 antibody

PAI-RBP1 (Plasminogen Activator Inhibitor 1 RNA-binding Protein, PAI1 RNA-Binding Protein 1, SERPINE1 mRNA-binding Protein 1, SERBP1, PAIRBP1, CGI-55)

Cat. Num. AAA643124

• Gene Names: SERBP1; CGI-55; CHD3IP; HABP4L; PAIRBP1; PAI-RBP1
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PAI-RBP1; Monoclonal Antibody; PAI-RBP1 (Plasminogen Activator Inhibitor 1 RNA-binding Protein; PAI1 RNA-Binding Protein 1; SERPINE1 mRNA-binding Protein 1; SERBP1; PAIRBP1; CGI-55); Anti -PAI-RBP1 (Plasminogen Activator Inhibitor 1 RNA-binding Protein; anti-SERBP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D2-2E9
• Specificity: Recognizes human PAI-RBP1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEG

• Applicable Applications for anti-SERBP1 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunofluorescence.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length recombinant corresponding to aa1-403 from human PAI-RBP1 (AAH02488) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (70.33kD).)

Western Blot (WB)

(PAI-RBP1 monoclonal antibody Western Blot analysis of PAI-RBP1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of SERBP1 expression in transfected 293T cell line by PAI-RBP1 monoclonal antibody.|Lane 1: SERBP1 transfected lysate (45kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAI-RBP1 on HeLa cell. [antibody concentration 10ug/ml])

Related Product Information for anti-SERBP1 antibody

May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

Product Categories/Family for anti-SERBP1 antibody

Antibodies; Abs to RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 66346685
• NCBI GeneID: 26135
• NCBI Accession #: NP_056455.3
• NCBI GenBank Nucleotide #: NM_015640.3
• UniProt Accession #: Q8NC51; Q5VU19; Q5VU20; Q5VU22; Q8WUH0; Q96SE2; Q9BTY3; Q9BUM4; Q9Y367; Q9Y4S3
• Molecular Weight: 44,965 Da
• NCBI Official Full Name: plasminogen activator inhibitor 1 RNA-binding protein isoform 4
• NCBI Official Synonym Full Names: SERPINE1 mRNA binding protein 1
• NCBI Official Symbol: SERBP1
• NCBI Official Synonym Symbols: CGI-55; CHD3IP; HABP4L; PAIRBP1; PAI-RBP1
• NCBI Protein Information: plasminogen activator inhibitor 1 RNA-binding protein; PAI-1 mRNA binding protein; PAI1 RNA-binding protein 1; SERPINE1 mRNA-binding protein 1; plasminogen activator inhibitor 1 RNA binding protein; chromodomain helicase DNA binding protein 3 interacting protein
• UniProt Protein Name: Plasminogen activator inhibitor 1 RNA-binding protein
• Protein Family: Plasminogen activator inhibitor 1 RNA-binding protein
• UniProt Gene Name: SERBP1
• UniProt Synonym Gene Names: PAIRBP1; PAI-RBP1
• UniProt Entry Name: PAIRB_HUMAN

Uniprot Description

PAI-RBP1: a predicted RNA-binding protein. May specifically binds the mRNA of type-1 plasminogen activator inhibitor (PAI-1), and is thought to be involved in regulation of mRNA stability. A related rat protein RDA288 plays a significant role in mediating the anti-apoptotic action of progesterone in granulosa cells.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 1p31

Cellular Component: membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; nucleus

Molecular Function: protein binding; mRNA 3'-UTR binding

Biological Process: regulation of apoptosis; regulation of mRNA stability