Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of PAPSS2 over-expressed 293 cell line, cotransfected with PAPSS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human, Mouse PAPSS2 Monoclonal Antibody | anti-PAPSS2 antibody

PAPSS2 (PAPS Synthase 2, PAPSS 2, 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, ATPSK2, Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, Sulfurylase Kinase 2, SK 2, SK2) (FITC)

Gene Names
PAPSS2; SK2; BCYM4; ATPSK2
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAPSS2; Monoclonal Antibody; PAPSS2 (PAPS Synthase 2; PAPSS 2; 3'-phosphoadenosine 5'-phosphosulfate Synthase 2; ATPSK2; Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 2; Sulfurylase Kinase 2; SK 2; SK2) (FITC); anti-PAPSS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A8
Specificity
Recognizes human PAPSS2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PAPSS2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa513-613 from PAPSS2 (NP_004661) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western blot analysis of PAPSS2 over-expressed 293 cell line, cotransfected with PAPSS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PAPSS2 over-expressed 293 cell line, cotransfected with PAPSS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Detection limit for recombinant GST tagged PAPSS2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PAPSS2 is ~0.03ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAPSS2 on A-431 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PAPSS2 on A-431 cell. [antibody concentration 10ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Western Blot (WB)

(Western Blot analysis of PAPSS2 expression in transfected 293T cell line by PAPSS2 monoclonal antibody. Lane 1: PAPSS2 transfected lysate (69.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PAPSS2 expression in transfected 293T cell line by PAPSS2 monoclonal antibody. Lane 1: PAPSS2 transfected lysate (69.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-PAPSS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 isoform a
NCBI Official Synonym Full Names
3'-phosphoadenosine 5'-phosphosulfate synthase 2
NCBI Official Symbol
PAPSS2
NCBI Official Synonym Symbols
SK2; BCYM4; ATPSK2
NCBI Protein Information
bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
UniProt Protein Name
Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
UniProt Gene Name
PAPSS2
UniProt Synonym Gene Names
ATPSK2; PAPS synthase 2; PAPSS 2; SK 2; SK2; SAT

NCBI Description

Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Bifunctional enzyme with both ATP sulfurylase and APS kinase activity, which mediates two steps in the sulfate activation pathway. The first step is the transfer of a sulfate group to ATP to yield adenosine 5'-phosphosulfate (APS), and the second step is the transfer of a phosphate group from ATP to APS yielding 3'-phosphoadenylylsulfate (PAPS: activated sulfate donor used by sulfotransferase). In mammals, PAPS is the sole source of sulfate; APS appears to be only an intermediate in the sulfate-activation pathway. May have a important role in skeletogenesis during postnatal growth ().

Research Articles on PAPSS2

Similar Products

Product Notes

The PAPSS2 papss2 (Catalog #AAA6148669) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAPSS2 (PAPS Synthase 2, PAPSS 2, 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, ATPSK2, Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, Sulfurylase Kinase 2, SK 2, SK2) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PAPSS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAPSS2 papss2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAPSS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.