Mouse anti-Human PAPPA Monoclonal Antibody | anti-PAPPA antibody

PAPPA (Pappalysin-1, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Pregnancy-associated Plasma Protein A, PAPP-A) (FITC)

Cat. Num. AAA6148667

• Gene Names: PAPPA; PAPA; DIPLA1; PAPP-A; PAPPA1; ASBABP2; IGFBP-4ase
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAPPA; Monoclonal Antibody; PAPPA (Pappalysin-1; Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease; IGF-dependent IGFBP-4 Protease; IGFBP-4ase; Pregnancy-associated Plasma Protein A; PAPP-A) (FITC); anti-PAPPA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G3
• Specificity: Recognizes human PAPPA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PAPPA antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa85-195 from human PAPPA (NP_002572) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Related Product Information for anti-PAPPA antibody

PAPP A (PAPP-A, Insulin-like growth factor binding protein-4 protease, PAPP-A-proMBP complex) was originally isolated from pregnancy serum as heterotetrameric protein complex with molecular weight approximately 500kD, consisting of two PAPP A subunits disulfide-linked with two subunits of the proform of eosinophil major basic protein (proMBP). In such a complex proMBP functions as an inhibitor of PAPP A proteinase activity. PAPP A is widely used as a marker of some pathologies during pregnancy. Low maternal serum levels of PAPP-A in first trimester biochemical screening is used as a marker of Down's syndrome (Trisomy 21).

Product Categories/Family for anti-PAPPA antibody

Antibodies; Hormones; Steroids

NCBI and Uniprot Product Information

• NCBI GI #: 223590248
• NCBI GeneID: 5069
• NCBI Accession #: NP_002572
• NCBI GenBank Nucleotide #: NM_002581
• NCBI Official Full Name: Pappalysin-1
• NCBI Official Synonym Full Names: pregnancy-associated plasma protein A, pappalysin 1
• NCBI Official Symbol: PAPPA
• NCBI Official Synonym Symbols: PAPA; DIPLA1; PAPP-A; PAPPA1; ASBABP2; IGFBP-4ase
• NCBI Protein Information: pappalysin-1; IGF-dependent IGFBP-4 protease; aspecific BCL2 ARE-binding protein 2; differentially placenta 1 expressed protein; insulin-like growth factor-dependent IGF binding protein-4 protease; insulin-like growth factor-dependent IGF-binding protein
• Protein Family: Pappalysin

NCBI Description

This gene encodes a secreted metalloproteinase which cleaves insulin-like growth factor binding proteins (IGFBPs). It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses. [provided by RefSeq, Jul 2008]