Mouse anti-Human PAI-RBP1 Monoclonal Antibody | anti-PAI-RBP1 antibody

PAI-RBP1 (Plasminogen Activator Inhibitor 1 RNA-binding Protein, PAI1 RNA-Binding Protein 1, SERPINE1 mRNA-binding Protein 1, SERBP1, PAIRBP1, CGI-55) APC

Cat. Num. AAA6138046

• Gene Names: SERBP1; CGI-55; CHD3IP; HABP4L; PAIRBP1; PAI-RBP1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAI-RBP1; Monoclonal Antibody; PAI-RBP1 (Plasminogen Activator Inhibitor 1 RNA-binding Protein; PAI1 RNA-Binding Protein 1; SERPINE1 mRNA-binding Protein 1; SERBP1; PAIRBP1; CGI-55) APC; anti-PAI-RBP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D2-2E9
• Specificity: Recognizes human PAI-RBP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-PAI-RBP1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-403 from human PAI-RBP1 (AAH02488) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (70.33kD).)

Western Blot (WB)

(PAI-RBP1 monoclonal antibody Western Blot analysis of PAI-RBP1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of SERBP1 expression in transfected 293T cell line by PAI-RBP1 monoclonal antibody. Lane 1: SERBP1 transfected lysate (45kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAI-RBP1 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-PAI-RBP1 antibody

Antibodies; RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33876749
• NCBI GeneID: 26135
• Molecular Weight: 42,427 Da
• NCBI Official Full Name: Homo sapiens SERPINE1 mRNA binding protein 1, mRNA
• NCBI Official Synonym Full Names: SERPINE1 mRNA binding protein 1
• NCBI Official Symbol: SERBP1
• NCBI Official Synonym Symbols: CGI-55; CHD3IP; HABP4L; PAIRBP1; PAI-RBP1
• NCBI Protein Information: plasminogen activator inhibitor 1 RNA-binding protein