Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in IMR-32 (Cat # L008V1).)

Mouse PAFAH1B3 Monoclonal Antibody | anti-PAFAH1B3 antibody

PAFAH1B3 (Platelet-Activating Factor acetylhydrolase, isoform Ib, gamma Subunit 29kD) (HRP)

Gene Names
PAFAH1B3; PAFAHG
Applications
Western Blot
Purity
Purified
Synonyms
PAFAH1B3; Monoclonal Antibody; PAFAH1B3 (Platelet-Activating Factor acetylhydrolase; isoform Ib; gamma Subunit 29kD) (HRP); Platelet-Activating Factor acetylhydrolase; gamma Subunit 29kD; anti-PAFAH1B3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G6
Specificity
Recognizes PAFAH1B3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
231
Applicable Applications for anti-PAFAH1B3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PAFAH1B3 (AAH03016, 1aa-231aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in IMR-32 (Cat # L008V1).)

Western Blot (WB) (PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in IMR-32 (Cat # L008V1).)

Testing Data

(Detection limit for recombinant GST tagged PAFAH1B3 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PAFAH1B3 is approximately 3ng/ml as a capture antibody.)

Western Blot (WB)

(PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB) (PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in PC-12 (Cat # L012V1).)

Western Blot (WB)

(PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in Raw 264.7 (Cat # L024V1).)

Western Blot (WB) (PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in Raw 264.7 (Cat # L024V1).)
Product Categories/Family for anti-PAFAH1B3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
NCBI Official Synonym Full Names
platelet activating factor acetylhydrolase 1b catalytic subunit 3
NCBI Official Symbol
PAFAH1B3
NCBI Official Synonym Symbols
PAFAHG
NCBI Protein Information
platelet-activating factor acetylhydrolase IB subunit gamma

NCBI Description

This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with cognitive disability, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]

Research Articles on PAFAH1B3

Similar Products

Product Notes

The PAFAH1B3 (Catalog #AAA6181554) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PAFAH1B3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAFAH1B3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAFAH1B3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.