Mouse PAFAH1B3 Monoclonal Antibody | anti-PAFAH1B3 antibody

PAFAH1B3 (Platelet-Activating Factor acetylhydrolase, isoform Ib, gamma Subunit 29kD) (FITC)

Cat. Num. AAA6177144

• Gene Names: PAFAH1B3; PAFAHG
• Applications: Western Blot
• Purity: Purified
• Synonyms: PAFAH1B3; Monoclonal Antibody; PAFAH1B3 (Platelet-Activating Factor acetylhydrolase; isoform Ib; gamma Subunit 29kD) (FITC); Platelet-Activating Factor acetylhydrolase; gamma Subunit 29kD; anti-PAFAH1B3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G6
• Specificity: Recognizes PAFAH1B3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 231

• Applicable Applications for anti-PAFAH1B3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PAFAH1B3 (AAH03016, 1aa-231aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in IMR-32 (Cat # L008V1).)

Testing Data

(Detection limit for recombinant GST tagged PAFAH1B3 is approximately 3ng/ml as a capture antibody.)

Western Blot (WB)

(PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in PC-12 (Cat # L012V1).)

Western Blot (WB)

(PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in Raw 264.7 (Cat # L024V1).)

Related Product Information for anti-PAFAH1B3 antibody

This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq]

Product Categories/Family for anti-PAFAH1B3 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 12804315
• NCBI GeneID: 5050
• NCBI Official Full Name: Platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
• NCBI Official Synonym Full Names: platelet activating factor acetylhydrolase 1b catalytic subunit 3
• NCBI Official Symbol: PAFAH1B3
• NCBI Official Synonym Symbols: PAFAHG
• NCBI Protein Information: platelet-activating factor acetylhydrolase IB subunit gamma
• Protein Family: Platelet-activating factor acetylhydrolase

NCBI Description

This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with cognitive disability, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]