Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (31.46kD).)

Mouse anti-Human P2RY1 Monoclonal Antibody | anti-P2RY1 antibody

P2RY1 (P2Y Purinoceptor 1, P2Y1, ATP Receptor, Purinergic Receptor) (FITC)

Gene Names
P2RY1; P2Y1; SARCC
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
P2RY1; Monoclonal Antibody; P2RY1 (P2Y Purinoceptor 1; P2Y1; ATP Receptor; Purinergic Receptor) (FITC); anti-P2RY1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C2
Specificity
Recognizes human P2RY1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-P2RY1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-53 from human P2RY1 (NP_002554) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.46kD).)

Western Blot (WB) (Western Blot detection against Immunogen (31.46kD).)

Testing Data

(Detection limit for recombinant GST tagged P2RY1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged P2RY1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-P2RY1 antibody
P2Y1 is a Purinergic Receptor that causes a change in platelet shape and potentially leads to platelet aggregation by binding ADP, which results in the mobilization of intracellular calcium ions via activation of phospholipase C. This receptor also mediates the release of the relaxing factor nitric oxide and may be involved in the modulation of neuronal signal transmission. P2Y1 has been reported to be expressed in tissues throughout the body, particularly brain. ESTs have been isolated from human embryo, lung, and placenta libraries.
Product Categories/Family for anti-P2RY1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
P2Y purinoceptor 1
NCBI Official Synonym Full Names
purinergic receptor P2Y1
NCBI Official Symbol
P2RY1
NCBI Official Synonym Symbols
P2Y1; SARCC
NCBI Protein Information
P2Y purinoceptor 1
UniProt Protein Name
P2Y purinoceptor 1
Protein Family
UniProt Gene Name
P2RY1
UniProt Synonym Gene Names
P2Y1
UniProt Entry Name
P2RY1_HUMAN

NCBI Description

The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation. [provided by RefSeq, Jul 2008]

Uniprot Description

P2RY1: Receptor for extracellular adenine nucleotides such as ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q25.2

Cellular Component: postsynaptic membrane; cell surface; mitochondrion; basolateral plasma membrane; integral to plasma membrane; dendrite; apical plasma membrane; plasma membrane

Molecular Function: ATP-activated nucleotide receptor activity; protein binding; purinergic nucleotide receptor activity, G-protein coupled; protein heterodimerization activity; A1 adenosine receptor binding; receptor activity; ADP binding; ATP binding; ADP-activated nucleotide receptor activity

Biological Process: platelet activation; regulation of vasodilation; eating behavior; positive regulation of hormone secretion; positive regulation of inositol trisphosphate biosynthetic process; negative regulation of binding; sensory perception of pain; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; response to mechanical stimulus; positive regulation of ion transport; positive regulation of transcription from RNA polymerase II promoter; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); regulation of receptor activity; G-protein signaling, adenylate cyclase inhibiting pathway; positive regulation of protein amino acid phosphorylation; blood coagulation; adenosine receptor signaling pathway; aging

Research Articles on P2RY1

Similar Products

Product Notes

The P2RY1 p2ry1 (Catalog #AAA6148641) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The P2RY1 (P2Y Purinoceptor 1, P2Y1, ATP Receptor, Purinergic Receptor) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's P2RY1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the P2RY1 p2ry1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "P2RY1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.