Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human P2RX5 Monoclonal Antibody | anti-P2RX5 antibody

P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (MaxLight 405)

Gene Names
P2RX5; P2X5; LRH-1; P2X5R
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
P2RX5; Monoclonal Antibody; P2RX5 (P2X5; P2X Purinoceptor 5; ATP Receptor; Purinergic Receptor; MGC47755) (MaxLight 405); anti-P2RX5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C5
Specificity
Recognizes human P2RX5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
422
Applicable Applications for anti-P2RX5 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa126-225 from human P2RX5 (NP_002552) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-P2RX5 antibody
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-P2RX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
P2X purinoceptor 5 isoform A
NCBI Official Synonym Full Names
purinergic receptor P2X 5
NCBI Official Symbol
P2RX5
NCBI Official Synonym Symbols
P2X5; LRH-1; P2X5R
NCBI Protein Information
P2X purinoceptor 5
UniProt Protein Name
P2X purinoceptor 5
Protein Family
UniProt Gene Name
P2RX5
UniProt Synonym Gene Names
P2X5; P2X5
UniProt Entry Name
P2RX5_HUMAN

NCBI Description

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream gene, TAX1BP3 (Tax1 binding protein 3). [provided by RefSeq, Mar 2011]

Uniprot Description

P2X5: Receptor for ATP that acts as a ligand-gated ion channel. Belongs to the P2X receptor family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: cytoplasm; integral to nuclear inner membrane; integral to plasma membrane; plasma membrane

Molecular Function: ATP binding; ATP-gated cation channel activity; ion channel activity; purinergic nucleotide receptor activity; transmembrane receptor activity

Biological Process: blood coagulation; nervous system development; positive regulation of calcium-mediated signaling; response to ATP; signal transduction; transport

Research Articles on P2RX5

Similar Products

Product Notes

The P2RX5 p2rx5 (Catalog #AAA6191595) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's P2RX5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the P2RX5 p2rx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "P2RX5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.