Rabbit anti-Human P2RX5 Polyclonal Antibody | anti-P2RX5 antibody

P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) APC

Cat. Num. AAA6388196

• Gene Names: P2RX5; P2X5; LRH-1; P2X5R
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: P2RX5; Polyclonal Antibody; P2RX5 (P2X5; P2X Purinoceptor 5; ATP Receptor; Purinergic Receptor; MGC47755) APC; anti-P2RX5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human P2RX5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-P2RX5 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human P2RX5, aa1-422 (NP_002552.2).
• Immunogen Sequence: MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of P2RX5 expression in transfected 293T cell line by P2RX5 polyclonal antibody. Lane 1: P2RX5 transfected lysate (47.2kD). Lane 2: Non-transfected lysate)

Related Product Information for anti-P2RX5 antibody

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene.

Product Categories/Family for anti-P2RX5 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 28416933
• NCBI GeneID: 5026
• NCBI Accession #: NP_002552.2
• NCBI GenBank Nucleotide #: NM_002561.2
• UniProt Accession #: Q93086
• Molecular Weight: 48
• NCBI Official Full Name: P2X purinoceptor 5 isoform A
• NCBI Official Synonym Full Names: purinergic receptor P2X 5
• NCBI Official Symbol: P2RX5
• NCBI Official Synonym Symbols: P2X5; LRH-1; P2X5R
• NCBI Protein Information: P2X purinoceptor 5
• UniProt Protein Name: P2X purinoceptor 5
• Protein Family: P2X purinoceptor
• UniProt Gene Name: P2RX5
• UniProt Synonym Gene Names: P2X5; P2X5
• UniProt Entry Name: P2RX5_HUMAN

NCBI Description

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream gene, TAX1BP3 (Tax1 binding protein 3). [provided by RefSeq, Mar 2011]

Uniprot Description

P2X5: Receptor for ATP that acts as a ligand-gated ion channel. Belongs to the P2X receptor family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: cytoplasm; integral to nuclear inner membrane; integral to plasma membrane; plasma membrane

Molecular Function: ATP binding; ATP-gated cation channel activity; ion channel activity; purinergic nucleotide receptor activity; transmembrane receptor activity

Biological Process: blood coagulation; nervous system development; positive regulation of calcium-mediated signaling; response to ATP; signal transduction; transport