Mouse anti-Human OSR1 Monoclonal Antibody | anti-OSR1 antibody

OSR1 (Protein Odd-skipped-related 1, ODD) (FITC)

Cat. Num. AAA6148629

• Gene Names: OSR1; ODD
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: OSR1; Monoclonal Antibody; OSR1 (Protein Odd-skipped-related 1; ODD) (FITC); anti-OSR1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3F3
• Specificity: Recognizes human OSR1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-OSR1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from human OSR1 (NP_660303) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to OSR1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to OSR1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged OSR1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-OSR1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 21687100
• NCBI GeneID: 130497
• NCBI Accession #: NP_660303
• NCBI GenBank Nucleotide #: NM_145260
• UniProt Accession #: Q8TAX0; B3KV97; D6W521
• Molecular Weight: 29,611 Da
• NCBI Official Full Name: protein odd-skipped-related 1
• NCBI Official Synonym Full Names: odd-skipped related transciption factor 1
• NCBI Official Symbol: OSR1
• NCBI Official Synonym Symbols: ODD
• NCBI Protein Information: protein odd-skipped-related 1; odd-skipped homolog; odd-skipped related 1
• UniProt Protein Name: Protein odd-skipped-related 1
• Protein Family: Protein odd-skipped
• UniProt Gene Name: OSR1
• UniProt Synonym Gene Names: ODD
• UniProt Entry Name: OSR1_HUMAN

Uniprot Description

ODD: Transcription factor that plays a role in the regulation of embryonic heart and urogenital development. Belongs to the Odd C2H2-type zinc-finger protein family.

Protein type: Apoptosis; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 2p24.1

Cellular Component: nucleus

Molecular Function: nucleic acid binding; metal ion binding

Biological Process: embryonic forelimb morphogenesis; gonad development; transcription, DNA-dependent; heart development; intermediate mesoderm development; negative regulation of epithelial cell differentiation; palate development; middle ear morphogenesis; negative regulation of transcription from RNA polymerase II promoter; stem cell differentiation; positive regulation of bone mineralization; embryonic hindlimb morphogenesis; pronephros development; odontogenesis; ureteric bud development; chondrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; mesonephros development; embryonic digit morphogenesis; cell differentiation; positive regulation of epithelial cell proliferation; urogenital system development; negative regulation of apoptosis