Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to OSR1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Mouse anti-Human OSR1 Monoclonal Antibody | anti-OSR1 antibody

OSR1 (Protein Odd-skipped-related 1, ODD) (HRP)

Gene Names
OSR1; ODD
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OSR1; Monoclonal Antibody; OSR1 (Protein Odd-skipped-related 1; ODD) (HRP); anti-OSR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F3
Specificity
Recognizes human OSR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-OSR1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human OSR1 (NP_660303) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to OSR1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Testing Data (Immunoperoxidase of monoclonal antibody to OSR1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to OSR1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to OSR1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged OSR1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged OSR1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-OSR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,611 Da
NCBI Official Full Name
protein odd-skipped-related 1
NCBI Official Synonym Full Names
odd-skipped related transciption factor 1
NCBI Official Symbol
OSR1
NCBI Official Synonym Symbols
ODD
NCBI Protein Information
protein odd-skipped-related 1; odd-skipped homolog; odd-skipped related 1
UniProt Protein Name
Protein odd-skipped-related 1
Protein Family
UniProt Gene Name
OSR1
UniProt Synonym Gene Names
ODD
UniProt Entry Name
OSR1_HUMAN

Uniprot Description

ODD: Transcription factor that plays a role in the regulation of embryonic heart and urogenital development. Belongs to the Odd C2H2-type zinc-finger protein family.

Protein type: Apoptosis; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 2p24.1

Cellular Component: nucleus

Molecular Function: nucleic acid binding; metal ion binding

Biological Process: embryonic forelimb morphogenesis; gonad development; transcription, DNA-dependent; heart development; intermediate mesoderm development; negative regulation of epithelial cell differentiation; palate development; middle ear morphogenesis; negative regulation of transcription from RNA polymerase II promoter; stem cell differentiation; positive regulation of bone mineralization; embryonic hindlimb morphogenesis; pronephros development; odontogenesis; ureteric bud development; chondrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; mesonephros development; embryonic digit morphogenesis; cell differentiation; positive regulation of epithelial cell proliferation; urogenital system development; negative regulation of apoptosis

Similar Products

Product Notes

The OSR1 osr1 (Catalog #AAA6153932) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The OSR1 (Protein Odd-skipped-related 1, ODD) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OSR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OSR1 osr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OSR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.