Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to ORC1L on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3ug/ml])

Mouse anti-Human ORC1L Monoclonal Antibody | anti-ORC1L antibody

ORC1L (Origin Recognition Complex Subunit 1, Replication Control Protein 1, ORC1, PARC1) (PE)

Gene Names
ORC1; ORC1L; PARC1; HSORC1
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ORC1L; Monoclonal Antibody; ORC1L (Origin Recognition Complex Subunit 1; Replication Control Protein 1; ORC1; PARC1) (PE); anti-ORC1L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3H1
Specificity
Recognizes human ORC1L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
3136
Applicable Applications for anti-ORC1L antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human ORC1L (AAH11539) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to ORC1L on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to ORC1L on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ORC1L is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ORC1L is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ORC1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens origin recognition complex, subunit 1-like (yeast), mRNA
NCBI Official Synonym Full Names
origin recognition complex subunit 1
NCBI Official Symbol
ORC1
NCBI Official Synonym Symbols
ORC1L; PARC1; HSORC1
NCBI Protein Information
origin recognition complex subunit 1

NCBI Description

The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is the largest subunit of the ORC complex. While other ORC subunits are stable throughout the cell cycle, the levels of this protein vary during the cell cycle, which has been shown to be controlled by ubiquitin-mediated proteolysis after initiation of DNA replication. This protein is found to be selectively phosphorylated during mitosis. It is also reported to interact with MYST histone acetyltransferase 2 (MyST2/HBO1), a protein involved in control of transcription silencing. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Research Articles on ORC1L

Similar Products

Product Notes

The ORC1L (Catalog #AAA6159227) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ORC1L (Origin Recognition Complex Subunit 1, Replication Control Protein 1, ORC1, PARC1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ORC1L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ORC1L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ORC1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.