Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Renin antibody used at 2.5 ug/ml to detect target protein.)

Rabbit Renin Polyclonal Antibody | anti-REN antibody

Renin Antibody

Gene Names
REN; HNFJ2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
Renin; Polyclonal Antibody; Renin Antibody; Rabbit Polyclonal Renin Antibody raised against the C terminal of REN; Polyclonal Renin antibody; Anti-Renin antibody; REN antibody; FLJ10761 antibody; anti-REN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Renin antibody was raised against the C terminal of REN
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
406
Applicable Applications for anti-REN antibody
Western Blot (WB)
Application Notes
This is a rabbit polyclonal antibody against REN, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
WB: 2.5 ug/ml
Immunogen
Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA
Cross-Reactivity
Human,Mouse,Rat
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Renin antibody used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (Renin antibody used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-REN antibody
Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.
Product Categories/Family for anti-REN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa (MW of target protein)
NCBI Official Full Name
renin preproprotein
NCBI Official Synonym Full Names
renin
NCBI Official Symbol
REN
NCBI Official Synonym Symbols
HNFJ2
NCBI Protein Information
renin
UniProt Protein Name
Renin
Protein Family
UniProt Gene Name
REN
UniProt Entry Name
RENI_HUMAN

NCBI Description

Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause familial hyperproreninemia. [provided by RefSeq, Jul 2008]

Uniprot Description

REN: Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. Interacts with ATP6AP2. Interaction with ATP6AP2 results in a 5-fold increased efficiency in angiotensinogen processing. Belongs to the peptidase A1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.23.15; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: extracellular space; cytoplasm; plasma membrane; extracellular region

Molecular Function: peptidase activity; insulin-like growth factor receptor binding; aspartic-type endopeptidase activity; receptor binding

Biological Process: response to cAMP; hormone-mediated signaling; drinking behavior; male gonad development; renin-angiotensin regulation of aldosterone production; cell maturation; response to lipopolysaccharide; angiotensin maturation; proteolysis; cellular protein metabolic process; regulation of blood pressure; regulation of MAPKKK cascade; beta-amyloid metabolic process; mesonephros development; kidney development

Disease: Renal Tubular Dysgenesis; Hyperuricemic Nephropathy, Familial Juvenile, 2

Research Articles on REN

Similar Products

Product Notes

The REN ren (Catalog #AAA5313165) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Renin Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Renin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). This is a rabbit polyclonal antibody against REN, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the REN ren for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Renin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.