Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged OR2A2 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human OR2A2 Monoclonal Antibody | anti-OR2A2 antibody

OR2A2 (Olfactory Receptor 2A2, Olfactory Receptor 2A17, Olfactory Receptor OR7-11, OR2A17P, OR2A2P, OST008) (Biotin)

Gene Names
OR2A2; OR2A2P; OR7-11; OST008; OR2A17P
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OR2A2; Monoclonal Antibody; OR2A2 (Olfactory Receptor 2A2; Olfactory Receptor 2A17; Olfactory Receptor OR7-11; OR2A17P; OR2A2P; OST008) (Biotin); anti-OR2A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B10
Specificity
Recognizes human OR2A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
318
Applicable Applications for anti-OR2A2 antibody
ELISA (EIA)
Application Notes
Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa261-319 from human OR2A2 (NP_001005480) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PDSNQREEQEKMLSLFHSVLNPMLNPLIYSLRNAQLKGALHRALQRKRSMRTVYGLCL*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged OR2A2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged OR2A2 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-OR2A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
olfactory receptor 2A2
NCBI Official Synonym Full Names
olfactory receptor family 2 subfamily A member 2
NCBI Official Symbol
OR2A2
NCBI Official Synonym Symbols
OR2A2P; OR7-11; OST008; OR2A17P
NCBI Protein Information
olfactory receptor 2A2
UniProt Protein Name
Olfactory receptor 2A2
Protein Family
UniProt Gene Name
OR2A2
UniProt Synonym Gene Names
OR2A17P; OR2A2P
UniProt Entry Name
OR2A2_HUMAN

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]

Uniprot Description

OR2A2: Odorant receptor (Potential). Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q35

Cellular Component: integral to membrane; plasma membrane

Molecular Function: olfactory receptor activity; taste receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; detection of chemical stimulus involved in sensory perception of smell; detection of chemical stimulus involved in sensory perception of taste

Similar Products

Product Notes

The OR2A2 or2a2 (Catalog #AAA6143317) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The OR2A2 (Olfactory Receptor 2A2, Olfactory Receptor 2A17, Olfactory Receptor OR7-11, OR2A17P, OR2A2P, OST008) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OR2A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OR2A2 or2a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OR2A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.