Mouse anti-Human NUP50 Monoclonal Antibody | anti-NUP50 antibody

NUP50 (NUP50, NPAP60L, Nuclear Pore Complex Protein Nup50, 50kD Nucleoporin, Nuclear Pore-associated Protein 60kD-like, Nucleoporin Nup50, MGC39961) (HRP)

Cat. Num. AAA6153898

• Gene Names: NUP50; NPAP60; NPAP60L
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NUP50; Monoclonal Antibody; NUP50 (NUP50; NPAP60L; Nuclear Pore Complex Protein Nup50; 50kD Nucleoporin; Nuclear Pore-associated Protein 60kD-like; Nucleoporin Nup50; MGC39961) (HRP); anti-NUP50 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4H7
• Specificity: Recognizes human NUP50.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 440

• Applicable Applications for anti-NUP50 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa342-439 from human NUP50 (NP_705931) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(NUP50 monoclonal antibody Western Blot analysis of NUP50 expression in Hela NE.)

Product Categories/Family for anti-NUP50 antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 24497447
• NCBI GeneID: 10762
• NCBI Accession #: NP_705931.1
• NCBI GenBank Nucleotide #: NM_153645
• UniProt Accession #: Q9UKX7
• NCBI Official Full Name: nuclear pore complex protein Nup50 isoform a
• NCBI Official Synonym Full Names: nucleoporin 50
• NCBI Official Symbol: NUP50
• NCBI Official Synonym Symbols: NPAP60; NPAP60L
• NCBI Protein Information: nuclear pore complex protein Nup50
• UniProt Protein Name: Nuclear pore complex protein Nup50
• Protein Family: Nuclear pore complex protein
• UniProt Gene Name: NUP50
• UniProt Synonym Gene Names: NPAP60L
• UniProt Entry Name: NUP50_HUMAN

NCBI Description

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NUP50: Component of the nuclear pore complex that has a direct role in nuclear protein import. Actively displaces NLSs from importin-alpha, and facilitates disassembly of the importin- alpha:beta-cargo complex and importin recycling. Interacts with multiple transport receptor proteins including CDKN1B. This interaction is required for correct intracellular transport and degradation of CDKN1B. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleoporin; Nuclear import

Chromosomal Location of Human Ortholog: 22q13.31

Cellular Component: nucleoplasm; nuclear membrane; cytoplasm; nuclear pore

Molecular Function: protein binding

Biological Process: mRNA transport; viral reproduction; cytokine and chemokine mediated signaling pathway; mitotic nuclear envelope disassembly; pathogenesis; glucose transport; viral infectious cycle; protein transport; intracellular transport; hexose transport; carbohydrate metabolic process; gene expression; viral transcription; mitotic cell cycle; transmembrane transport