Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NUCKS1 is 0.3 ng/ml as a capture antibody.)

Mouse NUCKS1 Monoclonal Antibody | anti-NUCKS1 antibody

NUCKS1 (Nuclear Casein Kinase and Cyclin-Dependent Kinase Substrate 1, FLJ21480, FLJ32016, FLJ38536, JC7, NUCKS) (AP)

Gene Names
NUCKS1; JC7; NUCKS
Applications
Western Blot
Purity
Purified
Synonyms
NUCKS1; Monoclonal Antibody; NUCKS1 (Nuclear Casein Kinase and Cyclin-Dependent Kinase Substrate 1; FLJ21480; FLJ32016; FLJ38536; JC7; NUCKS) (AP); Nuclear Casein Kinase and Cyclin-Dependent Kinase Substrate 1; NUCKS; anti-NUCKS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G10
Specificity
Recognizes NUCKS1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NUCKS1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NUCKS1 (NP_073568.2, 1aa-243aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NUCKS1 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NUCKS1 is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NUCKS1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NUCKS1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NUCKS1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NUCKS1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-NUCKS1 antibody
Mouse monoclonal antibody raised against a full-length recombinant NUCKS1.
Product Categories/Family for anti-NUCKS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,296 Da
NCBI Official Full Name
nuclear ubiquitous casein and cyclin-dependent kinase substrate 1
NCBI Official Synonym Full Names
nuclear casein kinase and cyclin-dependent kinase substrate 1
NCBI Official Symbol
NUCKS1
NCBI Official Synonym Symbols
JC7; NUCKS
NCBI Protein Information
nuclear ubiquitous casein and cyclin-dependent kinase substrate 1; P1; potential LAG1 interactor; nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate
UniProt Protein Name
Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1
UniProt Gene Name
NUCKS1
UniProt Synonym Gene Names
NUCKS
UniProt Entry Name
NUCKS_HUMAN

NCBI Description

This gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated in vivo by Cdk1 during mitosis of the cell cycle. [provided by RefSeq, Aug 2010]

Uniprot Description

NUCKS: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: cytoplasm; nucleus

Research Articles on NUCKS1

Similar Products

Product Notes

The NUCKS1 nucks1 (Catalog #AAA6165511) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NUCKS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUCKS1 nucks1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUCKS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.