Mouse NSD1 Monoclonal Antibody | anti-NSD1 antibody

NSD1 (Nuclear Receptor Binding SET Domain Protein 1, ARA267, DKFZp666C163, FLJ10684, FLJ22263, FLJ44628, KMT3B, SOTOS, STO) (FITC)

Cat. Num. AAA6177179

• Gene Names: NSD1; STO; KMT3B; SOTOS; ARA267; FLJ10684; FLJ22263; FLJ44628; DKFZp666C163
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: NSD1; Monoclonal Antibody; NSD1 (Nuclear Receptor Binding SET Domain Protein 1; ARA267; DKFZp666C163; FLJ10684; FLJ22263; FLJ44628; KMT3B; SOTOS; STO) (FITC); Nuclear Receptor Binding SET Domain Protein 1; STO; anti-NSD1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1C12
• Specificity: Recognizes NSD1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-NSD1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NSD1 (NP_071900, 2aa-109aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQT
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-NSD1 antibody

This gene encodes a protein containing a SET domain, 2 LXXLL motifs, 3 nuclear translocation signals (NLSs), 4 plant homeodomain (PHD) finger regions, and a proline-rich region. The encoded protein enhances androgen receptor (AR) transactivation, and this enhancement can be increased further in the presence of other androgen receptor associated coregulators. This protein may act as a nucleus-localized, basic transcriptional factor and also as a bifunctional transcriptional regulator. Mutations of this gene have been associated with Sotos syndrome and Weaver syndrome. One version of childhood acute myeloid leukemia is the result of a cryptic translocation with the breakpoints occurring within nuclear receptor-binding Su-var, enhancer of zeste, and trithorax domain protein 1 on chromosome 5 and nucleoporin, 98-kd on chromosome 11. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Product Categories/Family for anti-NSD1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 19923586
• NCBI GeneID: 64324
• NCBI Accession #: NP_071900
• NCBI GenBank Nucleotide #: NM_022455.4
• UniProt Accession #: Q96L73; Q96PD8; Q96RN7; Q658U6; Q6PJ64; Q8NB95; Q96DQ7; Q96MN8; Q9H6B5; Q9H6H8
• Molecular Weight: 296,652 Da
• NCBI Official Full Name: histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific isoform b
• NCBI Official Synonym Full Names: nuclear receptor binding SET domain protein 1
• NCBI Official Symbol: NSD1
• NCBI Official Synonym Symbols: STO; KMT3B; SOTOS; ARA267; FLJ10684; FLJ22263; FLJ44628; DKFZp666C163
• NCBI Protein Information: histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific; H3-K36-HMTase; H4-K20-HMTase; OTTHUMP00000161431; OTTHUMP00000161432; lysine N-methyltransferase 3B; NR-binding SET domain-containing protein; androgen receptor-associated coregul
• UniProt Protein Name: Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific
• Protein Family: Histone-lysine N-methyltransferase
• UniProt Gene Name: NSD1
• UniProt Synonym Gene Names: ARA267; KMT3B
• UniProt Entry Name: NSD1_HUMAN